(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE362

CP002209.PE362       Location/Qualifiers
FT   CDS             complement(396563..397822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0362"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR003004: IPR018076: IPR001992; KEGG:
FT                   shm:Shewmr7_3606 type II secretion system protein; PFAM:
FT                   Type II secretion system F domain; SPTR: A2UYK0 Type II
FT                   secretion system protein; PFAM: Bacterial type II secretion
FT                   system protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74576"
FT                   /db_xref="GOA:E1SN77"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN77"
FT                   /protein_id="ADN74576.1"
FT                   /translation="MAIAAKKRLKTSEPDKPALDVRTYLWKGKNSKGNSVKGELSGQTT
FT                   AEVKVLLRKQGITPLSVKKKPKALFERKAKIRGMDIAVVTRQIATMLLAGVPLVTAIEM
FT                   VGRSHENDAVRKLLAIILAEVQSGTPLSKALRPHRQYFDDLYCDLVAAGEHSGTLDQVF
FT                   DRIATYREKSEALKSKIKKAMFYPTAVVVVAISVTVLLLLFVVPQFEAIFNDFGAELPI
FT                   FTQIVINLSRFLSESWYYFLAAIVIVIWLFIRSHRNSQKFRDKVDHFLLKIPVVGPILD
FT                   KAAVARFSRTLATTFAAGVPLVDGLDSASGASGNALYRDAVMKIKEEVIAGLQMNVAMR
FT                   TTGLFPDMLIQMVMIGEESGALDDMLNKVASIYEAQVDDAVDGLSTLIEPIMMVVIGGL
FT                   VGGLVVAMYLPIFQLGNVVG"
     MAIAAKKRLK TSEPDKPALD VRTYLWKGKN SKGNSVKGEL SGQTTAEVKV LLRKQGITPL        60
     SVKKKPKALF ERKAKIRGMD IAVVTRQIAT MLLAGVPLVT AIEMVGRSHE NDAVRKLLAI       120
     ILAEVQSGTP LSKALRPHRQ YFDDLYCDLV AAGEHSGTLD QVFDRIATYR EKSEALKSKI       180
     KKAMFYPTAV VVVAISVTVL LLLFVVPQFE AIFNDFGAEL PIFTQIVINL SRFLSESWYY       240
     FLAAIVIVIW LFIRSHRNSQ KFRDKVDHFL LKIPVVGPIL DKAAVARFSR TLATTFAAGV       300
     PLVDGLDSAS GASGNALYRD AVMKIKEEVI AGLQMNVAMR TTGLFPDMLI QMVMIGEESG       360
     ALDDMLNKVA SIYEAQVDDA VDGLSTLIEP IMMVVIGGLV GGLVVAMYLP IFQLGNVVG        419
//

If you have problems or comments...

PBIL Back to PBIL home page