(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE365

CP002209.PE365       Location/Qualifiers
FT   CDS             complement(400171..401028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0365"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638: IPR004393; KEGG:
FT                   shn:Shewana3_0422 nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]; PFAM: Quinolinate phosphoribosyl
FT                   transferase; PRIAM: Nicotinate-nucleotide diphosphorylase
FT                   (carboxylating); SPTR: A2UYJ7 Nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase, C-terminal domain; Quinolinate phosphoribosyl
FT                   transferase, N-terminal domain; TIGRFAM:
FT                   nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74579"
FT                   /db_xref="GOA:E1SN80"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN80"
FT                   /protein_id="ADN74579.1"
FT                   /translation="MLENDIRLTVAAALDEDLGGQGPAQGDITAQLIPADRYAEATIIT
FT                   REDGVFCGKAWAEQVFNQLGGDVALHWHVDDGDLVVAGQTLCELAGPARLLLTGERTVL
FT                   NFIQTLSGVATTVSHYVAKLEGTQTRLLDTRKTLPGLRTAQKYAVTCGGGHNHRIGLFD
FT                   AFLIKENHIAACGGISPAIAAARQLRPEAPVEVEVENLEELKEALTGGADIVMLDNFDI
FT                   TMMLDAVTLNREQFEGRCKLEVSGDVTLATIGDFARTGVDFISVGALTKHVKAMDLSMR
FT                   FKAN"
     MLENDIRLTV AAALDEDLGG QGPAQGDITA QLIPADRYAE ATIITREDGV FCGKAWAEQV        60
     FNQLGGDVAL HWHVDDGDLV VAGQTLCELA GPARLLLTGE RTVLNFIQTL SGVATTVSHY       120
     VAKLEGTQTR LLDTRKTLPG LRTAQKYAVT CGGGHNHRIG LFDAFLIKEN HIAACGGISP       180
     AIAAARQLRP EAPVEVEVEN LEELKEALTG GADIVMLDNF DITMMLDAVT LNREQFEGRC       240
     KLEVSGDVTL ATIGDFARTG VDFISVGALT KHVKAMDLSM RFKAN                       285
//

If you have problems or comments...

PBIL Back to PBIL home page