(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE366

CP002209.PE366       Location/Qualifiers
FT   CDS             complement(401035..401550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0366"
FT                   /product="aspartyl protease"
FT                   /note="COGs: COG3577 aspartyl protease; InterPro IPR001969:
FT                   IPR011969; KEGG: ilo:IL2346 aspartyl protease; SPTR: A3WLN8
FT                   Predicted aspartyl protease; TIGRFAM: conserved
FT                   hypothetical protein TIGR02281"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74580"
FT                   /db_xref="GOA:E1SN81"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN81"
FT                   /protein_id="ADN74580.1"
FT                   /translation="MGTPSTPRRYGQTLFVLAWLVLAALLYLYFDSKLARQYNPNQRVA
FT                   SEISGQSIAVNLLRNRQGHYVASGQINGHDVVMMVDTGATRISIPESVATRLSLRRGQS
FT                   YPVETANGTVTVWHTRIDQLSIGALTLYDLDANINPGLGDSTILLGMNALKDLELIQRG
FT                   DTLTLRKY"
     MGTPSTPRRY GQTLFVLAWL VLAALLYLYF DSKLARQYNP NQRVASEISG QSIAVNLLRN        60
     RQGHYVASGQ INGHDVVMMV DTGATRISIP ESVATRLSLR RGQSYPVETA NGTVTVWHTR       120
     IDQLSIGALT LYDLDANINP GLGDSTILLG MNALKDLELI QRGDTLTLRK Y                171
//

If you have problems or comments...

PBIL Back to PBIL home page