(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE368

CP002209.PE368       Location/Qualifiers
FT   CDS             402222..403073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0368"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="COGs: COG3725 Membrane protein required for
FT                   beta-lactamase induction; KEGG: shl:Shal_0474 regulatory
FT                   protein AmpE; SPTR: A2UYJ5 Signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74582"
FT                   /db_xref="GOA:E1SN83"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN83"
FT                   /protein_id="ADN74582.1"
FT                   /translation="MALFSLIVVLLAERLRLVADAFQFEAWFGRYRRLMFDDQALRSPL
FT                   RMAVALVLPALVVWLAQRLLTGVWFGVLHLALWIGVGLLLFAHGPLRQRFRQYLEAARR
FT                   GDTQSCFNYADSLDESTAMQAASVEELGQRMGQLSAWLNYRYYAAVALYFVLLGPAMAT
FT                   FYCTVRAYCDHFAAQDCRRPLLGPLMKLLDWVPVRIVSLGFALSGHFSKAAPVLVPKVL
FT                   DPFSDPRRMITEVALAAEEVPETAGEPLCVQPTLALLKLAKRNFILLLVVVSLLTIFGV
FT                   IH"
     MALFSLIVVL LAERLRLVAD AFQFEAWFGR YRRLMFDDQA LRSPLRMAVA LVLPALVVWL        60
     AQRLLTGVWF GVLHLALWIG VGLLLFAHGP LRQRFRQYLE AARRGDTQSC FNYADSLDES       120
     TAMQAASVEE LGQRMGQLSA WLNYRYYAAV ALYFVLLGPA MATFYCTVRA YCDHFAAQDC       180
     RRPLLGPLMK LLDWVPVRIV SLGFALSGHF SKAAPVLVPK VLDPFSDPRR MITEVALAAE       240
     EVPETAGEPL CVQPTLALLK LAKRNFILLL VVVSLLTIFG VIH                         283
//

If you have problems or comments...

PBIL Back to PBIL home page