(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE37

CP002209.PE37        Location/Qualifiers
FT   CDS             complement(45766..46926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shl:Shal_2608 hypothetical protein; SPTR:
FT                   A3HYK0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74251"
FT                   /db_xref="InterPro:IPR022269"
FT                   /db_xref="UniProtKB/TrEMBL:E1SV97"
FT                   /protein_id="ADN74251.1"
FT                   /translation="MKYLYLPLLLGLLSCGGGGESASEPPPPEPPAPPPTNPDPADPAT
FT                   PCDAATSEVNWDALMSENCELLSQYGLFVDPAVPTRDARVPGLRYQLTTALFSDYASKY
FT                   RFLFLPPGTQMTYHDSETFGLPVGTVLVKTFALPADTALSGDDNETVIETRLLIHRESG
FT                   WVALPYLWQGNDAEFTPAGTLVAHQMIHQDETLAFNYEVPSQPQCKMCHQLSDGTTARF
FT                   SPIGIKARLLNRPGDNGSNQLQHWLSQGWLDRVPESIPTAADLYDTTASLTERAKGYLD
FT                   VNCAHCHRAEGFASISGLRLGYFVDHTTMEYGICKQPPGYDGGAAGLDYDIVPGNGLAS
FT                   ILPYRMAHLEPKDKMPPVGRAVVHDYAVDLIRNWIDTLDPALGSCQ"
     MKYLYLPLLL GLLSCGGGGE SASEPPPPEP PAPPPTNPDP ADPATPCDAA TSEVNWDALM        60
     SENCELLSQY GLFVDPAVPT RDARVPGLRY QLTTALFSDY ASKYRFLFLP PGTQMTYHDS       120
     ETFGLPVGTV LVKTFALPAD TALSGDDNET VIETRLLIHR ESGWVALPYL WQGNDAEFTP       180
     AGTLVAHQMI HQDETLAFNY EVPSQPQCKM CHQLSDGTTA RFSPIGIKAR LLNRPGDNGS       240
     NQLQHWLSQG WLDRVPESIP TAADLYDTTA SLTERAKGYL DVNCAHCHRA EGFASISGLR       300
     LGYFVDHTTM EYGICKQPPG YDGGAAGLDY DIVPGNGLAS ILPYRMAHLE PKDKMPPVGR       360
     AVVHDYAVDL IRNWIDTLDP ALGSCQ                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page