(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE370

CP002209.PE370       Location/Qualifiers
FT   CDS             404102..406768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0370"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="COGs: COG2609 Pyruvate dehydrogenase complex
FT                   dehydrogenase (E1) component; InterPro IPR004660; KEGG:
FT                   vpa:VP2519 pyruvate dehydrogenase subunit E1; SPTR: A3GNE4
FT                   Pyruvate dehydrogenase, E1 component; TIGRFAM: 2-oxo-acid
FT                   dehydrogenase E1 subunit, homodimeric type; PFAM:
FT                   Transketolase, thiamine diphosphate binding domain;
FT                   TIGRFAM: pyruvate dehydrogenase E1 component, homodimeric
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74584"
FT                   /db_xref="GOA:E1SN85"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN85"
FT                   /protein_id="ADN74584.1"
FT                   /translation="MSEPMNYDVDKQETQEWLESLAAVMQEDGLERAQFLLEQMISKAK
FT                   HEGVDLPTGITTNYINTIAPKDEPAYPGDSSLERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSAASFYEVGFNHFFRAPNAQDGGDLVYYQGHISPGIYARAFLEGRLSEEQLD
FT                   NFRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPISAIYQARFLKYLDGRGMKDTSAQ
FT                   RVYAFLGDGEMDEPESRGALSFAAREGLDNLCFLINCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVVKVIWGNGWDKLLAKDTSGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALQRGGHSSSKLYAAYMNAKNTKGKPTVILAKTVKGYGMGGA
FT                   AEGMNIAHQVKKMNAEHVRQLRDRLGLKDLVSDEQLMDLPYLKLDESSPEYRYLHARRE
FT                   ALHGYTPQRLPNFTQELALPKLESFQGLLDEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPKGQTYTPQDRDVVSYYKEATNGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHIMAGTIPNCISYDPTFAYEVAVIMQDGIQRMYGPAQENVFYYLTLM
FT                   NENYAQPAMPEGVEEGIRKGIYKLESHAGDNGKVQLLSSGTIMMQVREAARILADDYGI
FT                   GSDVFSVTSFNELTRDGQDAERWNMLHPTEQARVPYVTTVLGDAPAIAATDYMKNYAEQ
FT                   IRAFVPAQSYKVLGTDGFGRSDSRANLRRHFEVDAGYVVVAALSELAKQGKLDTAVVTE
FT                   AIAKFNIDADKQNPLYA"
     MSEPMNYDVD KQETQEWLES LAAVMQEDGL ERAQFLLEQM ISKAKHEGVD LPTGITTNYI        60
     NTIAPKDEPA YPGDSSLERR IRSIIRWNAI MIVLRASKKD LDLGGHMASY QSAASFYEVG       120
     FNHFFRAPNA QDGGDLVYYQ GHISPGIYAR AFLEGRLSEE QLDNFRQEVD GKGIPSYPHP       180
     KLMPEFWQFP TVSMGLGPIS AIYQARFLKY LDGRGMKDTS AQRVYAFLGD GEMDEPESRG       240
     ALSFAAREGL DNLCFLINCN LQRLDGPVMG NGKIIQELEG LFKGAGWNVV KVIWGNGWDK       300
     LLAKDTSGKL LQLMNETVDG DYQTYKAKNG AYVREHFFGR YPETAALVAD MTDDEIFALQ       360
     RGGHSSSKLY AAYMNAKNTK GKPTVILAKT VKGYGMGGAA EGMNIAHQVK KMNAEHVRQL       420
     RDRLGLKDLV SDEQLMDLPY LKLDESSPEY RYLHARREAL HGYTPQRLPN FTQELALPKL       480
     ESFQGLLDEQ KRDISTTMGF VRALNILLKD KGIGKNIVPI IADEARTFGM EGLFRQIGIY       540
     NPKGQTYTPQ DRDVVSYYKE ATNGQVLQEG INELGAMSSW VAAATSYSTN DLPMIPFYIY       600
     YSMFGFQRVG DMAWMAGDQQ ARGFLLGATA GRTTLNGEGL QHEDGHSHIM AGTIPNCISY       660
     DPTFAYEVAV IMQDGIQRMY GPAQENVFYY LTLMNENYAQ PAMPEGVEEG IRKGIYKLES       720
     HAGDNGKVQL LSSGTIMMQV REAARILADD YGIGSDVFSV TSFNELTRDG QDAERWNMLH       780
     PTEQARVPYV TTVLGDAPAI AATDYMKNYA EQIRAFVPAQ SYKVLGTDGF GRSDSRANLR       840
     RHFEVDAGYV VVAALSELAK QGKLDTAVVT EAIAKFNIDA DKQNPLYA                    888
//

If you have problems or comments...

PBIL Back to PBIL home page