(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE371

CP002209.PE371       Location/Qualifiers
FT   CDS             406783..408681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0371"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="COGs: COG0508 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide acyltransferase (E2) protein;
FT                   InterPro IPR004167: IPR000089: IPR001078: IPR003016: IPR
FT                   006256; KEGG: vsp:VS_2541 dihydrolipoamide
FT                   acetyltransferase; PFAM: catalytic domain of components of
FT                   various dehydrogenase complexes; biotin/lipoyl attachment
FT                   domain-containing protein; E3 binding domain protein;
FT                   PRIAM: Dihydrolipoyllysine-residue acetyltransferase; SPTR:
FT                   A3GNE3 Pyruvate dehydrogenase, E2 component,
FT                   dihydrolipoamide acetyltransferase; TIGRFAM: pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase;
FT                   PFAM: 2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); e3 binding domain; Biotin-requiring enzyme;
FT                   TIGRFAM: pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74585"
FT                   /db_xref="GOA:E1SN86"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN86"
FT                   /protein_id="ADN74585.1"
FT                   /translation="MTIEINVPDIGADEVEVTEILVQVGDRVEEEQSLISVEGDKASME
FT                   VPASAAGVVKEIKVAVGDKVATGSLIMVFEAEGGAAPAEQAAPAAVAEAPAAPAAASVQ
FT                   AVAVPDIGGDEVDVTELLVKVGDVVTEEQPLITVEGDKASMEVPAPFSGTVKSISINVG
FT                   DKVSTGSVIMEFEVTGGGAAAPVANAPAAAPAASGSEVKVVAVPDIGGDAVDVTELLVA
FT                   VGDRVTDEQPLITVEGDKASMEVPAPFAGVVKAIRIQVGDKVSTGTEIMEFEVEGAAPA
FT                   AVSAPAPAPAAAPAERKPAPSAPADSAEVASVEAATGFIENSAYAYATPVIRRMARELG
FT                   VDLSKVKGTGRKTRILKEDVHSYVKAALAQVQSGAVAPAGKHGGGLDLLPWPKVDFSKF
FT                   GEVESQPLSRIKKLSGANLARNWAMIPHVTQFDEADITDVEAFRKEQNAVVAKQELGFK
FT                   ITPLVFILKAVAKTLADLPQFNSSLSEDGESVILKKYIHIGVAVDTPNGLVVPVVRDVN
FT                   KKGIYELSEELMAISKKARAGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILG
FT                   VSKSEMKPVWNGKEFAPRLMLPLSLSYDHRVIDGADGARFSSTLAGYLSDIRKLVL"
     MTIEINVPDI GADEVEVTEI LVQVGDRVEE EQSLISVEGD KASMEVPASA AGVVKEIKVA        60
     VGDKVATGSL IMVFEAEGGA APAEQAAPAA VAEAPAAPAA ASVQAVAVPD IGGDEVDVTE       120
     LLVKVGDVVT EEQPLITVEG DKASMEVPAP FSGTVKSISI NVGDKVSTGS VIMEFEVTGG       180
     GAAAPVANAP AAAPAASGSE VKVVAVPDIG GDAVDVTELL VAVGDRVTDE QPLITVEGDK       240
     ASMEVPAPFA GVVKAIRIQV GDKVSTGTEI MEFEVEGAAP AAVSAPAPAP AAAPAERKPA       300
     PSAPADSAEV ASVEAATGFI ENSAYAYATP VIRRMARELG VDLSKVKGTG RKTRILKEDV       360
     HSYVKAALAQ VQSGAVAPAG KHGGGLDLLP WPKVDFSKFG EVESQPLSRI KKLSGANLAR       420
     NWAMIPHVTQ FDEADITDVE AFRKEQNAVV AKQELGFKIT PLVFILKAVA KTLADLPQFN       480
     SSLSEDGESV ILKKYIHIGV AVDTPNGLVV PVVRDVNKKG IYELSEELMA ISKKARAGKL       540
     TASDMQGGCF TISSLGGIGG TAFTPIVNAP EVAILGVSKS EMKPVWNGKE FAPRLMLPLS       600
     LSYDHRVIDG ADGARFSSTL AGYLSDIRKL VL                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page