(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE379

CP002209.PE379       Location/Qualifiers
FT   CDS             421619..422710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0379"
FT                   /product="PfkB domain protein"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR002139: IPR013196: IPR011611: IPR002173; KEGG:
FT                   slo:Shew_2725 ribokinase-like domain-containing protein;
FT                   PFAM: PfkB domain protein; Helix-turn-helix type 11 domain
FT                   protein; SPTR: P33020 Uncharacterized sugar kinase yeiI;
FT                   PFAM: HTH domain; pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74593"
FT                   /db_xref="GOA:E1SN94"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN94"
FT                   /protein_id="ADN74593.1"
FT                   /translation="MTEREQQILDLIRQDPLIPQQELADKLGISRSAIAGHIMHLTQKG
FT                   HIQGKGYILAPERYALVIGGANMDLCGVADRPLVDGDSTPGSLTASAGGVGRNIADNLA
FT                   RLGSRVEFVSALGDDRWAEQLIESCRLAGVGTEHCLKIAGATTSSYLSLHDSDGEMRLA
FT                   LNDMSLIERLDAEQMERRRGPIDRASVVVLDANLSEDALETLFARPLDAPVLVDPVSRA
FT                   KAHKLKPFLAQIDTLKPNALEAELLSGHRLDSDEDLPRVADALHQLGVKRVLLSLGSRG
FT                   AYASDAGQGVRYLPSATDVVNVTGAGDALMAGLAHGRLAGWSFTETVPFALAAARLALA
FT                   TKTTINSTMSEAAVRRLMEKTPC"
     MTEREQQILD LIRQDPLIPQ QELADKLGIS RSAIAGHIMH LTQKGHIQGK GYILAPERYA        60
     LVIGGANMDL CGVADRPLVD GDSTPGSLTA SAGGVGRNIA DNLARLGSRV EFVSALGDDR       120
     WAEQLIESCR LAGVGTEHCL KIAGATTSSY LSLHDSDGEM RLALNDMSLI ERLDAEQMER       180
     RRGPIDRASV VVLDANLSED ALETLFARPL DAPVLVDPVS RAKAHKLKPF LAQIDTLKPN       240
     ALEAELLSGH RLDSDEDLPR VADALHQLGV KRVLLSLGSR GAYASDAGQG VRYLPSATDV       300
     VNVTGAGDAL MAGLAHGRLA GWSFTETVPF ALAAARLALA TKTTINSTMS EAAVRRLMEK       360
     TPC                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page