(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE381

CP002209.PE381       Location/Qualifiers
FT   CDS             complement(423675..424295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0381"
FT                   /product="uracil-DNA glycosylase superfamily protein"
FT                   /note="COGs: COG1573 Uracil-DNA glycosylase; KEGG:
FT                   bac:BamMC406_4405 uracil-DNA glycosylase superfamily
FT                   protein; SPTR: A2VYJ6 Uracil-DNA glycosylase; PFAM: Uracil
FT                   DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74595"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN96"
FT                   /protein_id="ADN74595.1"
FT                   /translation="MTVCPTSASAAQIPISDDSTRELIHTVHACRLCQDVLDPNPVVQL
FT                   ASSARLLIIGQAPGLKVHQSGIPWNDASGDRLRHWLGMDRDTFYDPSRVAIIPMGLCYP
FT                   GRGRSGDNPPDKRCAPRWHPTLLAQLPALELTLYIGQYAQKHYLEGFTSLTDTVARWAE
FT                   FGPDRFPLPHPSPRNTLWLKRHPWFDDDVVPALRQRVQGLMAG"
     MTVCPTSASA AQIPISDDST RELIHTVHAC RLCQDVLDPN PVVQLASSAR LLIIGQAPGL        60
     KVHQSGIPWN DASGDRLRHW LGMDRDTFYD PSRVAIIPMG LCYPGRGRSG DNPPDKRCAP       120
     RWHPTLLAQL PALELTLYIG QYAQKHYLEG FTSLTDTVAR WAEFGPDRFP LPHPSPRNTL       180
     WLKRHPWFDD DVVPALRQRV QGLMAG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page