(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE384

CP002209.PE384       Location/Qualifiers
FT   CDS             complement(427740..428648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0384"
FT                   /product="Patatin"
FT                   /note="COGs: COG4667 esterase of the alpha-beta hydrolase
FT                   superfamily; InterPro IPR002641; KEGG: vpa:VPA1288
FT                   hypothetical protein; PFAM: Patatin; SPTR: A0XXZ8 Putative
FT                   ratatin-like phospholipase or esterase of the alpha-beta
FT                   hydrolase superfamily protein; PFAM: Patatin-like
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74598"
FT                   /db_xref="GOA:E1SN99"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:E1SN99"
FT                   /protein_id="ADN74598.1"
FT                   /translation="MDQVGPSALIVEGGAMRGVFSCGVLDTFLARDFSPFDSFWGVSAG
FT                   ASNLAAYLAKMPGRNRKIYTDYSCRRAFLTPGRFLRGGDLMDLDWMWTITLAELGIDKA
FT                   VLAADPRPFFLAVTRQDSGQAEYHTPDVEQLAETMKASSALPVLYRKGVRLGQHTYVDG
FT                   GVADALPVAEAIRRGARQIMVLRSRPASYRKSASGLPALQRWLLRDTPHLVEPMLSRAE
FT                   RYNRTLDLIRQPPEGVNIVEICPPESFRLKRLTRDAEPLERGYELGRIAGEAAMARWQP
FT                   FSGDGQSPAPQCHRSNPAPAV"
     MDQVGPSALI VEGGAMRGVF SCGVLDTFLA RDFSPFDSFW GVSAGASNLA AYLAKMPGRN        60
     RKIYTDYSCR RAFLTPGRFL RGGDLMDLDW MWTITLAELG IDKAVLAADP RPFFLAVTRQ       120
     DSGQAEYHTP DVEQLAETMK ASSALPVLYR KGVRLGQHTY VDGGVADALP VAEAIRRGAR       180
     QIMVLRSRPA SYRKSASGLP ALQRWLLRDT PHLVEPMLSR AERYNRTLDL IRQPPEGVNI       240
     VEICPPESFR LKRLTRDAEP LERGYELGRI AGEAAMARWQ PFSGDGQSPA PQCHRSNPAP       300
     AV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page