(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE386

CP002209.PE386       Location/Qualifiers
FT   CDS             complement(431282..431674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0386"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="COGs: COG2030 Acyl dehydratase; InterPro IPR003965:
FT                   IPR002539; KEGG: spl:Spea_1753 dehydratase; PFAM: MaoC
FT                   domain protein dehydratase; SPTR: A9UWL2 Predicted protein;
FT                   PFAM: MaoC like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74600"
FT                   /db_xref="GOA:E1SNA1"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA1"
FT                   /protein_id="ADN74600.1"
FT                   /translation="MTLQPGQSAEIQKVFGPAEVAAFAELSEDRNPIHLDAEFAAQTPF
FT                   GHPIVHGILLSSLLSGLLGQHLPGQGTIYLGQTLKFVRPVLVGEAVTARVTVAQVRDDK
FT                   PIVTLTTEVVNAKGEPCVQGEAVVKV"
     MTLQPGQSAE IQKVFGPAEV AAFAELSEDR NPIHLDAEFA AQTPFGHPIV HGILLSSLLS        60
     GLLGQHLPGQ GTIYLGQTLK FVRPVLVGEA VTARVTVAQV RDDKPIVTLT TEVVNAKGEP       120
     CVQGEAVVKV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page