(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE392

CP002209.PE392       Location/Qualifiers
FT   CDS             437386..437862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0392"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="COGs: COG2453 protein-tyrosine phosphatase; InterPro
FT                   IPR016130: IPR000387; KEGG: vcj:VCD_003270 protein tyrosine
FT                   phosphatase; SPTR: A2P602 Phosphatase, putative; PFAM: Dual
FT                   specificity phosphatase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74606"
FT                   /db_xref="GOA:E1SNA7"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR022778"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA7"
FT                   /protein_id="ADN74606.1"
FT                   /translation="MAFEPAFIDVNGLPMALHPAPGLEGRLKEDVALLAAAGVAAVVTT
FT                   LTEEELTRFGIPTLGQEVEAAGMQWVHLPVQDKSLPDAEFDAAWAEQREMLTALMESGK
FT                   RVSVHCRGGTGRTGLVAAKLLLDSGADWQETLDRVREARPGALEQDSQLGYLQR"
     MAFEPAFIDV NGLPMALHPA PGLEGRLKED VALLAAAGVA AVVTTLTEEE LTRFGIPTLG        60
     QEVEAAGMQW VHLPVQDKSL PDAEFDAAWA EQREMLTALM ESGKRVSVHC RGGTGRTGLV       120
     AAKLLLDSGA DWQETLDRVR EARPGALEQD SQLGYLQR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page