(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE393

CP002209.PE393       Location/Qualifiers
FT   CDS             437968..438462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0393"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   swd:Swoo_1851 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: A2UVD1 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74607"
FT                   /db_xref="GOA:E1SNA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNA8"
FT                   /protein_id="ADN74607.1"
FT                   /translation="MSITIRRAEPSDAEALQATMSAEICFSNTLQLPWPSLTMWQQRLA
FT                   QLGPDQHLLVAENDAGDVVGNLMLAQASNPRRRHVAEIGMAVVPEWQGRGVGSALLQAA
FT                   INLGEQWLALTRLELDVYTDNEAALALYRRHGFEPEGIARAAAFRDGARVDVMRMARIR
FT                   D"
     MSITIRRAEP SDAEALQATM SAEICFSNTL QLPWPSLTMW QQRLAQLGPD QHLLVAENDA        60
     GDVVGNLMLA QASNPRRRHV AEIGMAVVPE WQGRGVGSAL LQAAINLGEQ WLALTRLELD       120
     VYTDNEAALA LYRRHGFEPE GIARAAAFRD GARVDVMRMA RIRD                        164
//

If you have problems or comments...

PBIL Back to PBIL home page