(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE395

CP002209.PE395       Location/Qualifiers
FT   CDS             complement(439210..439620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0395"
FT                   /product="protein of unknown function DUF307"
FT                   /note="COGs: COG3304 membrane protein; InterPro IPR005185;
FT                   KEGG: dma:DMR_26390 hypothetical protein; PFAM: protein of
FT                   unknown function DUF307; SPTR: A2V407 Putative
FT                   uncharacterized protein; PFAM: Domain of unknown function
FT                   (DUF307)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74609"
FT                   /db_xref="GOA:E1SNB0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB0"
FT                   /protein_id="ADN74609.1"
FT                   /translation="MDLLRFIGNVIWLIWGGIAMALGWALVGVILALTIIGLPWARSCF
FT                   VIAQLSLWPFGKDVANRRVVNREDDIGTGALGTIGNVIWFLVAGLWLALGHLFFAVTLF
FT                   CTIIGIPFGLQHVKLAMLTVAPIGYTLVDDPD"
     MDLLRFIGNV IWLIWGGIAM ALGWALVGVI LALTIIGLPW ARSCFVIAQL SLWPFGKDVA        60
     NRRVVNREDD IGTGALGTIG NVIWFLVAGL WLALGHLFFA VTLFCTIIGI PFGLQHVKLA       120
     MLTVAPIGYT LVDDPD                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page