(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE397

CP002209.PE397       Location/Qualifiers
FT   CDS             440012..442363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0397"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG1643 HrpA-like helicase; InterPro
FT                   IPR007502: IPR011545: IPR001650: IPR014001: IPR 014021:
FT                   IPR019825; KEGG: swd:Swoo_4927 helicase domain-containing
FT                   protein; PFAM: helicase domain protein; helicase-associated
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; SPTR:
FT                   A3UVI8 Putative ATP-dependent helicase; PFAM: Helicase
FT                   conserved C-terminal domain; Helicase associated domain
FT                   (HA2); DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74611"
FT                   /db_xref="GOA:E1SNB2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB2"
FT                   /protein_id="ADN74611.1"
FT                   /translation="MSAIASLPIDPLQPQFLEHLRHHHLVVEADTGSGKSTRLPIWAAQ
FT                   LGRVLVVEPRRVACTALAEFLAAESGQPLGEQVGYAIRFDSNVMDTTEVAFVTPGIALR
FT                   WLTEDGLAGFHTVIIDEFHERRWDTDLLLALLQRRQQHRLVLTSATVDGVRLADYLGGE
FT                   RLYAEGRRFEVQIQHQARDSHSLPDDRGLVQRVADAVADQLAAREGDVLVFLPGRKEIS
FT                   QCEASLKAALGDRALVLPLHASVPRPLQRQALTAGPQRRVILATNVAETSLTIPGVTVV
FT                   IDSGLERRTRQRNGRTVLALTRISQASAAQRAGRAGRVAPGVCVRLWGQHAPLEALTPP
FT                   ELQREELVEPMLAAACAGAVLSDLRFVDPLPEKSLLLAQQRLRAMAAIDGLGGVTEHGR
FT                   RLFPLPIDTQFAHLITAMPDKPCMEAMVDLAAALSLGQRLWRLPASEAGRQALKAWQPQ
FT                   PCDGLTLVMLLRQSPPEALAIDPALHSEARQLAEQIRAALALPQLSASSHLPYRRWCEA
FT                   ILAAMPELAFVRRAKRRDALGNGVMEVQPGRESRFAEEAEAALVLDQHSLPGRGHKQTL
FT                   NLATCMMPLTLAQLVEAGLGEVRQGELNQGETGLLVTQERVYAGRVIEQRLAQPEGEQG
FT                   RQAMVQSILDGQLLAPAGAQLQADARAWALWLGLGLGEGEPIDPQAWLLQQLADLGVES
FT                   EQDLALIEPQDLHFEGIPEWQRAEFDERFPHFLVLAELKLHVEYQPRAKRVTVVYAEGS
FT                   RKSDPKRWELPSWAGWRVQYRRASRVVDVR"
     MSAIASLPID PLQPQFLEHL RHHHLVVEAD TGSGKSTRLP IWAAQLGRVL VVEPRRVACT        60
     ALAEFLAAES GQPLGEQVGY AIRFDSNVMD TTEVAFVTPG IALRWLTEDG LAGFHTVIID       120
     EFHERRWDTD LLLALLQRRQ QHRLVLTSAT VDGVRLADYL GGERLYAEGR RFEVQIQHQA       180
     RDSHSLPDDR GLVQRVADAV ADQLAAREGD VLVFLPGRKE ISQCEASLKA ALGDRALVLP       240
     LHASVPRPLQ RQALTAGPQR RVILATNVAE TSLTIPGVTV VIDSGLERRT RQRNGRTVLA       300
     LTRISQASAA QRAGRAGRVA PGVCVRLWGQ HAPLEALTPP ELQREELVEP MLAAACAGAV       360
     LSDLRFVDPL PEKSLLLAQQ RLRAMAAIDG LGGVTEHGRR LFPLPIDTQF AHLITAMPDK       420
     PCMEAMVDLA AALSLGQRLW RLPASEAGRQ ALKAWQPQPC DGLTLVMLLR QSPPEALAID       480
     PALHSEARQL AEQIRAALAL PQLSASSHLP YRRWCEAILA AMPELAFVRR AKRRDALGNG       540
     VMEVQPGRES RFAEEAEAAL VLDQHSLPGR GHKQTLNLAT CMMPLTLAQL VEAGLGEVRQ       600
     GELNQGETGL LVTQERVYAG RVIEQRLAQP EGEQGRQAMV QSILDGQLLA PAGAQLQADA       660
     RAWALWLGLG LGEGEPIDPQ AWLLQQLADL GVESEQDLAL IEPQDLHFEG IPEWQRAEFD       720
     ERFPHFLVLA ELKLHVEYQP RAKRVTVVYA EGSRKSDPKR WELPSWAGWR VQYRRASRVV       780
     DVR                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page