(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE399

CP002209.PE399       Location/Qualifiers
FT   CDS             442939..443151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74613"
FT                   /db_xref="GOA:E1SNB4"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB4"
FT                   /protein_id="ADN74613.1"
FT                   /translation="MNSVWITRLVAMVGAGLWCLLHFLNTRFTALKRQIPLTAKRQAPA
FT                   SNARSGGKRAVPWNIQAPAFASVNS"
     MNSVWITRLV AMVGAGLWCL LHFLNTRFTA LKRQIPLTAK RQAPASNARS GGKRAVPWNI        60
     QAPAFASVNS                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page