(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE403

CP002209.PE403       Location/Qualifiers
FT   CDS             444675..444959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74617"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNB8"
FT                   /protein_id="ADN74617.1"
FT                   /translation="MYIHVHRCRLALPNAVHGAFFVDPTGTLEVELAGKTEPLHANLAE
FT                   LSFWPEETGDCRLCCGQHWQLRLKPDDAQSLQGLISDAREELASLHRDL"
     MYIHVHRCRL ALPNAVHGAF FVDPTGTLEV ELAGKTEPLH ANLAELSFWP EETGDCRLCC        60
     GQHWQLRLKP DDAQSLQGLI SDAREELASL HRDL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page