(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE406

CP002209.PE406       Location/Qualifiers
FT   CDS             445636..446034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74620"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC1"
FT                   /protein_id="ADN74620.1"
FT                   /translation="MTLMDPLGLEPALVEHGCAQPGLYRAFVPLFIQYYGRMHRCLDVN
FT                   ESPGNAIRDFNAMALAFMDVVEDQHLPLERELLAEFGIDLSFDRRDPQRRAALTGTACY
FT                   QNCYDRLTATVMPVVQMQSLSYGARLGR"
     MTLMDPLGLE PALVEHGCAQ PGLYRAFVPL FIQYYGRMHR CLDVNESPGN AIRDFNAMAL        60
     AFMDVVEDQH LPLERELLAE FGIDLSFDRR DPQRRAALTG TACYQNCYDR LTATVMPVVQ       120
     MQSLSYGARL GR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page