(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE407

CP002209.PE407       Location/Qualifiers
FT   CDS             446200..446652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74621"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC2"
FT                   /protein_id="ADN74621.1"
FT                   /translation="MGQTLERYLQYRDDLEGAGYFRWMEQLYRAGGWQSRDEMHAAASQ
FT                   MGDPDQVRHLNFYAVTGLLDEMVQLYRQYGEALAQRPGTDLTPASPPSTFVAQTLSAPA
FT                   DARLPIVQQWAQIVAVLTDNMVAEAQQQEYGEISPSVTESPLGSES"
     MGQTLERYLQ YRDDLEGAGY FRWMEQLYRA GGWQSRDEMH AAASQMGDPD QVRHLNFYAV        60
     TGLLDEMVQL YRQYGEALAQ RPGTDLTPAS PPSTFVAQTL SAPADARLPI VQQWAQIVAV       120
     LTDNMVAEAQ QQEYGEISPS VTESPLGSES                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page