(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE408

CP002209.PE408       Location/Qualifiers
FT   CDS             446649..447263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3247 conserved hypothetical protein;
FT                   InterPro IPR005325; KEGG: mxa:MXAN_3732 hypothetical
FT                   protein; SPTR: A0NLE4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74622"
FT                   /db_xref="GOA:E1SNC3"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC3"
FT                   /protein_id="ADN74622.1"
FT                   /translation="MIKTTLDAALTLGRRSGIFLLILGILSVAMPWATGLALEMLLGIL
FT                   LLCAGVAQLFFAFRTRELSGFPLRLVFGLLTSFAGLYLLFNPTAGVVAITLILGIYFLI
FT                   DGLATLLASFQYRAQRNWLMMFANGAVTLALAAVILWQWPASGRYVIGILVGIKLIMMG
FT                   LMMITTAGMVSAAKDRMDAVRAQQRADGAKVVDGEDRTVDP"
     MIKTTLDAAL TLGRRSGIFL LILGILSVAM PWATGLALEM LLGILLLCAG VAQLFFAFRT        60
     RELSGFPLRL VFGLLTSFAG LYLLFNPTAG VVAITLILGI YFLIDGLATL LASFQYRAQR       120
     NWLMMFANGA VTLALAAVIL WQWPASGRYV IGILVGIKLI MMGLMMITTA GMVSAAKDRM       180
     DAVRAQQRAD GAKVVDGEDR TVDP                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page