(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE41

CP002209.PE41        Location/Qualifiers
FT   CDS             complement(52016..53383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0041"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020459:
FT                   IPR000873: IPR010192; KEGG: slo:Shew_3602
FT                   O-succinylbenzoate-CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; SPTR: A2V3Q7 O-succinylbenzoate-CoA
FT                   ligase; TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-binding enzyme; TIGRFAM: O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74255"
FT                   /db_xref="GOA:E1SVA1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA1"
FT                   /protein_id="ADN74255.1"
FT                   /translation="MNLILCPLHSAARRWGDAIAVCGPEGSLSYEALDGRVTALAHHLA
FT                   GQGLQAGDHIGYLGQNRLEAILLLYAAMRLGAVFAPLSPRFPEAQRDQLIRELDIQWCW
FT                   SEGELPEGVRALSVTSASEAQRWQVDLDRPLTLILTSGSSGHPKAAMHGLAQHIAAAEG
FT                   SHDQTPLNRGDRWLLSLPLFHIGGLAILFRCLSCGATAVLPGHQDLASNLRQQRITHLS
FT                   LVATQLVRLLERDDADEVMRSITTLLLGGGAIPASLLERLKPYPIKVLTSYGMTEMGSQ
FT                   ITTGPANDQGLSGYPLAGRQVRLNEGLIEVRGDCRFLGYYANGTLTRPFDHEGWFATRD
FT                   LGQFVGEQLKVLGRADNMFVSGGENVQPEAIESVLKRCEGVEEAIIIPVEDEVFGHLPV
FT                   AVVKGAWQPEQWEKRVLKKLPRFMRPRRYLPWPEALNQTGLKVSRKAIAEYVHQQG"
     MNLILCPLHS AARRWGDAIA VCGPEGSLSY EALDGRVTAL AHHLAGQGLQ AGDHIGYLGQ        60
     NRLEAILLLY AAMRLGAVFA PLSPRFPEAQ RDQLIRELDI QWCWSEGELP EGVRALSVTS       120
     ASEAQRWQVD LDRPLTLILT SGSSGHPKAA MHGLAQHIAA AEGSHDQTPL NRGDRWLLSL       180
     PLFHIGGLAI LFRCLSCGAT AVLPGHQDLA SNLRQQRITH LSLVATQLVR LLERDDADEV       240
     MRSITTLLLG GGAIPASLLE RLKPYPIKVL TSYGMTEMGS QITTGPANDQ GLSGYPLAGR       300
     QVRLNEGLIE VRGDCRFLGY YANGTLTRPF DHEGWFATRD LGQFVGEQLK VLGRADNMFV       360
     SGGENVQPEA IESVLKRCEG VEEAIIIPVE DEVFGHLPVA VVKGAWQPEQ WEKRVLKKLP       420
     RFMRPRRYLP WPEALNQTGL KVSRKAIAEY VHQQG                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page