(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE410

CP002209.PE410       Location/Qualifiers
FT   CDS             448143..449561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0410"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="COGs: COG2704 Anaerobic C4-dicarboxylate
FT                   transporter; InterPro IPR004668; KEGG: spl:Spea_0685
FT                   anaerobic C4-dicarboxylate transporter; PFAM: anaerobic
FT                   c4-dicarboxylate membrane transporter; SPTR: A3XS28
FT                   Anaerobic C4-dicarboxylate transporter; TIGRFAM: anaerobic
FT                   c4-dicarboxylate antiporter, Dcu family; PFAM: Anaerobic
FT                   c4-dicarboxylate membrane transporter; TIGRFAM: anaerobic
FT                   c4-dicarboxylate membrane transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74624"
FT                   /db_xref="GOA:E1SNC5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNC5"
FT                   /protein_id="ADN74624.1"
FT                   /translation="MFYVHMLLLFAVIFVGIRYGGIAFGLLGGLGVSILSFVFGVAPGN
FT                   PPIGVMLIILAVVAASATLEATGGLKLLVKYAEKLLRKHPSKVVFLGPLCTYSLTVLVG
FT                   TGHSVYPLLPVIYDVSIKRGIRPERPMAMATIASQMGITASPIAAAAAVVMATAATNQL
FT                   DITLGQVLLVTIPATLTGVLIAATWSLKRGKELNQDPEFLARCQDPQFKAQLIDESDAK
FT                   SDKPEHDGQKAKRGLTVFLLGIVTVIFVAMFGKTLGLLPDGVKTSTALQFLMLSVGAII
FT                   LLSTNIDPKKIVKTNVFVAGMSAVIIIFGIAWMSDTIISHNKPYIISLVEDVVKTHPWT
FT                   FAIAMYVASVFLKSQAAVLTIMLPLGFTLGIPGEVLIGVLPACYAYYFFPFYPSDLAAI
FT                   TFDRSGTTRIGKYILNHSFFIPGFIGVFSATCIGYALSVGLLPIWLWGIAIVGLALAVN
FT                   LYMNRLSSETLTLA"
     MFYVHMLLLF AVIFVGIRYG GIAFGLLGGL GVSILSFVFG VAPGNPPIGV MLIILAVVAA        60
     SATLEATGGL KLLVKYAEKL LRKHPSKVVF LGPLCTYSLT VLVGTGHSVY PLLPVIYDVS       120
     IKRGIRPERP MAMATIASQM GITASPIAAA AAVVMATAAT NQLDITLGQV LLVTIPATLT       180
     GVLIAATWSL KRGKELNQDP EFLARCQDPQ FKAQLIDESD AKSDKPEHDG QKAKRGLTVF       240
     LLGIVTVIFV AMFGKTLGLL PDGVKTSTAL QFLMLSVGAI ILLSTNIDPK KIVKTNVFVA       300
     GMSAVIIIFG IAWMSDTIIS HNKPYIISLV EDVVKTHPWT FAIAMYVASV FLKSQAAVLT       360
     IMLPLGFTLG IPGEVLIGVL PACYAYYFFP FYPSDLAAIT FDRSGTTRIG KYILNHSFFI       420
     PGFIGVFSAT CIGYALSVGL LPIWLWGIAI VGLALAVNLY MNRLSSETLT LA               472
//

If you have problems or comments...

PBIL Back to PBIL home page