(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE418

CP002209.PE418       Location/Qualifiers
FT   CDS             complement(456149..457045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0418"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: aha:AHA_1683 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: A3GYM4 Membrane
FT                   protein; PFAM: Membrane protein of unknown function
FT                   (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74632"
FT                   /db_xref="GOA:E1SNY3"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY3"
FT                   /protein_id="ADN74632.1"
FT                   /translation="MDTLVILSPLVVGYLIPLRHRPTLQLIDRALTAIIYLILGLMGVG
FT                   LGSMDNLAGEIGGILTLTLTLIGLTLVANIAALPLVDKRWPLSLGQQEGEVRTFAMVVE
FT                   SLQLAGVVLAGFMLGLLFPQPSAHIESGVNLILMLLLLLIGIQLRASGMSLRQILLNPR
FT                   GLAIAAAVLGTSLLAGAATAWLWQLPIHHGMALAAGTGWYSLSGALVSAKLGPAMGSVA
FT                   FLADLCRELIAIILIPLMMRRQPATAIGYGGATAMDFTLPIIQKSGGPQTVPIAIVSGF
FT                   VLSLAGPILIPFFLSLG"
     MDTLVILSPL VVGYLIPLRH RPTLQLIDRA LTAIIYLILG LMGVGLGSMD NLAGEIGGIL        60
     TLTLTLIGLT LVANIAALPL VDKRWPLSLG QQEGEVRTFA MVVESLQLAG VVLAGFMLGL       120
     LFPQPSAHIE SGVNLILMLL LLLIGIQLRA SGMSLRQILL NPRGLAIAAA VLGTSLLAGA       180
     ATAWLWQLPI HHGMALAAGT GWYSLSGALV SAKLGPAMGS VAFLADLCRE LIAIILIPLM       240
     MRRQPATAIG YGGATAMDFT LPIIQKSGGP QTVPIAIVSG FVLSLAGPIL IPFFLSLG         298
//

If you have problems or comments...

PBIL Back to PBIL home page