(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE42

CP002209.PE42        Location/Qualifiers
FT   CDS             complement(53380..54315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0042"
FT                   /product="o-succinylbenzoate synthase"
FT                   /note="COGs: COG1441 O-succinylbenzoate synthase; InterPro
FT                   IPR013342: IPR018110; KEGG: aha:AHA_0528 O-succinylbenzoic
FT                   acid (OSB) synthetase; PFAM: Mandelate racemase/muconate
FT                   lactonizing protein; PRIAM: o-succinylbenzoate synthase;
FT                   SPTR: B1JH91 o-succinylbenzoate synthase; PFAM: Mandelate
FT                   racemase / muconate lactonizing enzyme, C-terminal domain;
FT                   TIGRFAM: o-succinylbenzoic acid (OSB) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74256"
FT                   /db_xref="GOA:E1SVA2"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA2"
FT                   /protein_id="ADN74256.1"
FT                   /translation="MKLYPYALPLATPLRFAGQSLDQRHGLLIKLERDGHTGWGDCAPL
FT                   PGFSHESLAQCQSALQALASGQIDEAALPPAARFALDCARWQCEGPRRLTLPANIPLLV
FT                   GTPEQQLAQFDALTTPPGEVKLKLARAPLEQEIALVYALLERQPKLLLRIDANRGWSAE
FT                   QASHFAASVPPAALRYVEEPCANLNDSLRVAAQHRLPLALDETTQVADYQYESLPGVRA
FT                   LVLKPTLIGSLARLQQLVQQARLDGVEVVLSSSFESNIGLTHLAHLAAELTPDSVPGLD
FT                   TLAPLGADLLEANPWGLAKPVITESELTPL"
     MKLYPYALPL ATPLRFAGQS LDQRHGLLIK LERDGHTGWG DCAPLPGFSH ESLAQCQSAL        60
     QALASGQIDE AALPPAARFA LDCARWQCEG PRRLTLPANI PLLVGTPEQQ LAQFDALTTP       120
     PGEVKLKLAR APLEQEIALV YALLERQPKL LLRIDANRGW SAEQASHFAA SVPPAALRYV       180
     EEPCANLNDS LRVAAQHRLP LALDETTQVA DYQYESLPGV RALVLKPTLI GSLARLQQLV       240
     QQARLDGVEV VLSSSFESNI GLTHLAHLAA ELTPDSVPGL DTLAPLGADL LEANPWGLAK       300
     PVITESELTP L                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page