(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE420

CP002209.PE420       Location/Qualifiers
FT   CDS             complement(457522..457719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR014271; KEGG: shn:Shewana3_1157
FT                   hypothetical protein; SPTR: A2V061 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF2375);
FT                   TIGRFAM: conserved hypothetical protein TIGR02922"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74634"
FT                   /db_xref="InterPro:IPR014271"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY5"
FT                   /protein_id="ADN74634.1"
FT                   /translation="MELRDVTVLFFDSDESLVMKKAVVRGMATENGSRVQLPEHFREGK
FT                   VIVAVLNGDVEVLSLVGDRI"
     MELRDVTVLF FDSDESLVMK KAVVRGMATE NGSRVQLPEH FREGKVIVAV LNGDVEVLSL        60
     VGDRI                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page