(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE422

CP002209.PE422       Location/Qualifiers
FT   CDS             459350..460108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_2105 hypothetical protein; SPTR:
FT                   Q50658 Uncharacterized protein Rv2307c/MT2364"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74636"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNY7"
FT                   /protein_id="ADN74636.1"
FT                   /translation="MAQLGRILLWLVLIYLLLCLAMTLSQRHLLYLPTPKAPASVPALR
FT                   LAGPEGDLVVHPVQPGRANAVFYFGGNAEAVYRSADSLARALPGCTLYLVNYPGYGGSA
FT                   GQPSEATLTAAALSAYDQLSSGHQQLAAIGRSLGSAVALSLAARRPLQRQALLTPFASL
FT                   EALAYEHYPWLPASLLLWDRYDLLALAPAVTSPSLVLLAQQDRVVPLAASSPLLSALKA
FT                   PTIVEVAGTHNRFDATASLAAFFHPICGAL"
     MAQLGRILLW LVLIYLLLCL AMTLSQRHLL YLPTPKAPAS VPALRLAGPE GDLVVHPVQP        60
     GRANAVFYFG GNAEAVYRSA DSLARALPGC TLYLVNYPGY GGSAGQPSEA TLTAAALSAY       120
     DQLSSGHQQL AAIGRSLGSA VALSLAARRP LQRQALLTPF ASLEALAYEH YPWLPASLLL       180
     WDRYDLLALA PAVTSPSLVL LAQQDRVVPL AASSPLLSAL KAPTIVEVAG THNRFDATAS       240
     LAAFFHPICG AL                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page