(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE425

CP002209.PE425       Location/Qualifiers
FT   CDS             461599..462147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0425"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="COGs: COG0262 Dihydrofolate reductase; InterPro
FT                   IPR002734; KEGG: ppr:PBPRB0448 putative dihydrofolate
FT                   reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein; SPTR: A3UPR3 Pyrimidine reductase; PFAM: RibD
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74639"
FT                   /db_xref="GOA:E1SNZ0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ0"
FT                   /protein_id="ADN74639.1"
FT                   /translation="MSNVVYIATSLDGFIADRDGGLDWLHSVPNPQGDDLGFAAFLAGI
FT                   DALLMGRNTYQSILDFNLDLPSQWPYPKPVYVVGSSPITIPDALEGKVFALAPAEPAEM
FT                   MATLAQMGHRHLYLDGGNTIQRFMAQGLVDELIISQIPVVLGGGVPLFGALPTMQSYEL
FT                   VSSEVMLGAMVKSHYRRIR"
     MSNVVYIATS LDGFIADRDG GLDWLHSVPN PQGDDLGFAA FLAGIDALLM GRNTYQSILD        60
     FNLDLPSQWP YPKPVYVVGS SPITIPDALE GKVFALAPAE PAEMMATLAQ MGHRHLYLDG       120
     GNTIQRFMAQ GLVDELIISQ IPVVLGGGVP LFGALPTMQS YELVSSEVML GAMVKSHYRR       180
     IR                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page