(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE426

CP002209.PE426       Location/Qualifiers
FT   CDS             complement(462213..462872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0426"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006664:
FT                   IPR006665: IPR008816; KEGG: asa:ASA_4258 putative outer
FT                   membrane lipoprotein; PFAM: OmpA/MotB domain protein; 17
FT                   kDa surface antigen; SPTR: P37665 Inner membrane
FT                   lipoprotein yiaD; PFAM: Rickettsia 17 kDa surface antigen;
FT                   OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74640"
FT                   /db_xref="GOA:E1SNZ1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ1"
FT                   /protein_id="ADN74640.1"
FT                   /translation="MRTPMISALAAAALVLGGCASTDPYTGEQKTSNATSGALIGAVSG
FT                   ALIGAASSSKSDRGKGILIGAASGAAVGGGIGHYMDRQEAALREKLAGTGVSVKRDGDH
FT                   IQLVMPNSLTFDVGSDRLKMPAINALSGVAMVVSEFDETNLQITGHTDSTGGRDLNMRL
FT                   SRERAEAVASELLRQSISATRMSTYGAGPDRPIASNQSEAGRAENRRVEIVLTPRT"
     MRTPMISALA AAALVLGGCA STDPYTGEQK TSNATSGALI GAVSGALIGA ASSSKSDRGK        60
     GILIGAASGA AVGGGIGHYM DRQEAALREK LAGTGVSVKR DGDHIQLVMP NSLTFDVGSD       120
     RLKMPAINAL SGVAMVVSEF DETNLQITGH TDSTGGRDLN MRLSRERAEA VASELLRQSI       180
     SATRMSTYGA GPDRPIASNQ SEAGRAENRR VEIVLTPRT                              219
//

If you have problems or comments...

PBIL Back to PBIL home page