(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE427

CP002209.PE427       Location/Qualifiers
FT   CDS             complement(463018..463359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0427"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="InterPro IPR009671; KEGG: slo:Shew_2467 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1260; SPTR:
FT                   A2V2X8 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1260)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74641"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ2"
FT                   /protein_id="ADN74641.1"
FT                   /translation="MAFPNDANGELLSLMQQEGIDLTQPYMLDFYVVFGSEKQGQLTAE
FT                   AVTEAFPGAGVFLNLSEDTGQWELRLQQEMVPEYEAIGAIEARLAELAKPFKGKTDGWG
FT                   MLEPEDEEE"
     MAFPNDANGE LLSLMQQEGI DLTQPYMLDF YVVFGSEKQG QLTAEAVTEA FPGAGVFLNL        60
     SEDTGQWELR LQQEMVPEYE AIGAIEARLA ELAKPFKGKT DGWGMLEPED EEE              113
//

If you have problems or comments...

PBIL Back to PBIL home page