(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE429

CP002209.PE429       Location/Qualifiers
FT   CDS             complement(463768..467769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0429"
FT                   /product="Ricin B lectin"
FT                   /note="COGs: COG3240 Phospholipase/lecithinase/hemolysin;
FT                   InterPro IPR000772: IPR003367: IPR001087; KEGG:
FT                   saz:Sama_1102 ATPase; PFAM: Ricin B lectin; Thrombospondin
FT                   type 3 repeat; lipolytic protein G-D-S-L family; SMART:
FT                   Ricin B lectin; SPTR: A0YMB1 Putative uncharacterized
FT                   protein; PFAM: Ricin-type beta-trefoil lectin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74643"
FT                   /db_xref="GOA:E1SNZ4"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ4"
FT                   /protein_id="ADN74643.1"
FT                   /translation="MPYHATGRALPLPVILTSLWLVPLSHGISAPFNAQLQNQRTALCV
FT                   AVAQASGQSGANVVPTDCIALQPEQTLAFTPVATLADTYTLSFSHSGQCLDVSGGSDAN
FT                   GASLIQTPCDGRISQQFRAINEGSQWVIYTGTGSGDKVVDSHAYEADIIQWQDFGNDNQ
FT                   RWTLLNVSEGQDRDGDGVADDNDAFPDDPNEWADSDGDNLGDNSDPFPLDPDNDSDGDG
FT                   FGVNDDAFPDDPNEWLDSDGDGQGDNGDPFPLDASNDSDGDGVSGHIDNCPDDANADQS
FT                   DRDNDGLGDLCDPEPDGPVQPDAQFSAQLINQRTGQCIAVELGSSNAGANVAPATCIDQ
FT                   QPEQTLNFVAIAGLDDGYTLAFAHSGQCLDVAGGSPDNGATLIQTPCDDRASQRFRALD
FT                   EGSQWVLYTGTGDGSKVVDSHARESDIIQWKDLGKDNQRWRLQLVSQDPDRDGDGVPDT
FT                   LDPFPDDPDEWADSDGDGLGDNSDPFPSDPDNDIDGDGFGANDDAFPDDPNEWLDSDSD
FT                   GQGDNGDPFPLDPNNDRDGDGISGHIDNCPNDANADQSDRDNDGLGDVCDPEPDGPAEP
FT                   EADFSAQLRNQRTGLCVAVTGASQQAGANVAPDDCNAQNPEQALNFVSLDSNTGRYTLQ
FT                   FAHSGQCLDVAGGSPDNGATLVQSPCDGRASQQFRAIDEGTRWVIYTGTGDGTKVVDSH
FT                   ARESDIIQWKDLGKDNQRWLLERLSQGDDRDGDGIPDDQDRFPDDPGEWADSDDDGLGD
FT                   NSDPFPFDPDNDSDGDGFGANDDAFPDDGSEWVDSDGDGQGDNGDPFPLDANNDSDGDG
FT                   VSGHIDNCPNDANADQSDRDGDGLGDVCDSEPDGPAPPDSSWTAQLQNQRTGLCIAVTA
FT                   ASTSSGANVAPAGCIEQRSEQVLSFVPVTGLDNGFTLMFGHSGQCLDVAGGSDANGATL
FT                   VQTPCDGRASQRFIAIDEGTQWALYTGTGSGDKVVDSHAYESDIIQWQDFGNDNQRWLL
FT                   VYRSDDLDADNDGIPLGEDNCPLVANSDQVDSDNDGLGDPCDPYPFDPDNAPPLPASFS
FT                   SLQVMGNSYGERFESNGDIYATRLAEALGIAIDNVSRSGATTSQIINGRGGDPGQLLQL
FT                   LGDPAVADADALYVLWGGFNDVYYGDDSSPRSLSAAINDLATILDTLEQAGARYVMVPN
FT                   LLDVGLWPAVTGSDVAAHRLRSLTFNAQLQLMLQARQGSLRVVEFEVFDWADAIAANPS
FT                   DYGISELSVPCEDREPVSGSSDAPVADCRGYLFWDDFHLAAEVHQRIAERMQSLLALEA
FT                   APQSWVDSDVDGVPDHRDDFPSDDSEQYDSDGDGVGNNSDADPADPQLW"
     MPYHATGRAL PLPVILTSLW LVPLSHGISA PFNAQLQNQR TALCVAVAQA SGQSGANVVP        60
     TDCIALQPEQ TLAFTPVATL ADTYTLSFSH SGQCLDVSGG SDANGASLIQ TPCDGRISQQ       120
     FRAINEGSQW VIYTGTGSGD KVVDSHAYEA DIIQWQDFGN DNQRWTLLNV SEGQDRDGDG       180
     VADDNDAFPD DPNEWADSDG DNLGDNSDPF PLDPDNDSDG DGFGVNDDAF PDDPNEWLDS       240
     DGDGQGDNGD PFPLDASNDS DGDGVSGHID NCPDDANADQ SDRDNDGLGD LCDPEPDGPV       300
     QPDAQFSAQL INQRTGQCIA VELGSSNAGA NVAPATCIDQ QPEQTLNFVA IAGLDDGYTL       360
     AFAHSGQCLD VAGGSPDNGA TLIQTPCDDR ASQRFRALDE GSQWVLYTGT GDGSKVVDSH       420
     ARESDIIQWK DLGKDNQRWR LQLVSQDPDR DGDGVPDTLD PFPDDPDEWA DSDGDGLGDN       480
     SDPFPSDPDN DIDGDGFGAN DDAFPDDPNE WLDSDSDGQG DNGDPFPLDP NNDRDGDGIS       540
     GHIDNCPNDA NADQSDRDND GLGDVCDPEP DGPAEPEADF SAQLRNQRTG LCVAVTGASQ       600
     QAGANVAPDD CNAQNPEQAL NFVSLDSNTG RYTLQFAHSG QCLDVAGGSP DNGATLVQSP       660
     CDGRASQQFR AIDEGTRWVI YTGTGDGTKV VDSHARESDI IQWKDLGKDN QRWLLERLSQ       720
     GDDRDGDGIP DDQDRFPDDP GEWADSDDDG LGDNSDPFPF DPDNDSDGDG FGANDDAFPD       780
     DGSEWVDSDG DGQGDNGDPF PLDANNDSDG DGVSGHIDNC PNDANADQSD RDGDGLGDVC       840
     DSEPDGPAPP DSSWTAQLQN QRTGLCIAVT AASTSSGANV APAGCIEQRS EQVLSFVPVT       900
     GLDNGFTLMF GHSGQCLDVA GGSDANGATL VQTPCDGRAS QRFIAIDEGT QWALYTGTGS       960
     GDKVVDSHAY ESDIIQWQDF GNDNQRWLLV YRSDDLDADN DGIPLGEDNC PLVANSDQVD      1020
     SDNDGLGDPC DPYPFDPDNA PPLPASFSSL QVMGNSYGER FESNGDIYAT RLAEALGIAI      1080
     DNVSRSGATT SQIINGRGGD PGQLLQLLGD PAVADADALY VLWGGFNDVY YGDDSSPRSL      1140
     SAAINDLATI LDTLEQAGAR YVMVPNLLDV GLWPAVTGSD VAAHRLRSLT FNAQLQLMLQ      1200
     ARQGSLRVVE FEVFDWADAI AANPSDYGIS ELSVPCEDRE PVSGSSDAPV ADCRGYLFWD      1260
     DFHLAAEVHQ RIAERMQSLL ALEAAPQSWV DSDVDGVPDH RDDFPSDDSE QYDSDGDGVG      1320
     NNSDADPADP QLW                                                         1333
//

If you have problems or comments...

PBIL Back to PBIL home page