(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE430

CP002209.PE430       Location/Qualifiers
FT   CDS             complement(467851..469347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0430"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="InterPro IPR013105: IPR019734: IPR013026; KEGG:
FT                   xoo:XOO4397 hypothetical protein; PFAM: Tetratricopeptide
FT                   TPR_2 repeat protein; SPTR: A3S0L3 Tetratricopeptide repeat
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74644"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ5"
FT                   /protein_id="ADN74644.1"
FT                   /translation="MNWQQGYNAVSVAHLVRTALEKEDLTTAIELCHELNQRAPDYGPG
FT                   WHLAAEIALLRDNPASALAMAKRSLACQADSAAELLVVECHCRLGQYREGRAAARVLGH
FT                   GLPPSLALKRAELLLALHCPDDAAAQYRYLLETEGANPTLLSALADVLSEMGQLREAEQ
FT                   VLDQAIQLAPQQDALWTQRAYLRKQSEANHHIETLQFAIARRDRPCPQLHFALAKEWAD
FT                   LRCEDAAWHNLHLGARQQQAQQPYDASRDLSRLRAIRAHWSAPASKAAETTAEGPQPLF
FT                   LIGLPDGAIDALADHLAQHPQVFHLGAHQRFLPELERQLARQARLRDRPLWSTQAKLAA
FT                   SAQLDPAALGQAYLASLPPEAEEARWVIDTSPQHDQHLGLLLRALPHARAIAPLAPLSH
FT                   SGAALYQADPRQTGPYRYDPIELARYLKGHRALMQHWQRCHPEQLLCLDLNQPAGVATE
FT                   ALWHHLGFAPPPPSKAWPFVRPWGDIDSALPELLGALGKD"
     MNWQQGYNAV SVAHLVRTAL EKEDLTTAIE LCHELNQRAP DYGPGWHLAA EIALLRDNPA        60
     SALAMAKRSL ACQADSAAEL LVVECHCRLG QYREGRAAAR VLGHGLPPSL ALKRAELLLA       120
     LHCPDDAAAQ YRYLLETEGA NPTLLSALAD VLSEMGQLRE AEQVLDQAIQ LAPQQDALWT       180
     QRAYLRKQSE ANHHIETLQF AIARRDRPCP QLHFALAKEW ADLRCEDAAW HNLHLGARQQ       240
     QAQQPYDASR DLSRLRAIRA HWSAPASKAA ETTAEGPQPL FLIGLPDGAI DALADHLAQH       300
     PQVFHLGAHQ RFLPELERQL ARQARLRDRP LWSTQAKLAA SAQLDPAALG QAYLASLPPE       360
     AEEARWVIDT SPQHDQHLGL LLRALPHARA IAPLAPLSHS GAALYQADPR QTGPYRYDPI       420
     ELARYLKGHR ALMQHWQRCH PEQLLCLDLN QPAGVATEAL WHHLGFAPPP PSKAWPFVRP       480
     WGDIDSALPE LLGALGKD                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page