(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE433

CP002209.PE433       Location/Qualifiers
FT   CDS             complement(473509..474225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0433"
FT                   /product="protein of unknown function DUF28"
FT                   /note="COGs: COG0217 conserved hypothetical protein;
FT                   InterPro IPR002876; KEGG: sbn:Sbal195_1323 hypothetical
FT                   protein; PFAM: protein of unknown function DUF28; SPTR:
FT                   Q15YF9 UPF0082 protein Patl_0550; PFAM: Domain of unknown
FT                   function DUF28; TIGRFAM: conserved hypothetical protein
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74647"
FT                   /db_xref="GOA:E1SNZ8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E1SNZ8"
FT                   /protein_id="ADN74647.1"
FT                   /translation="MGRSFEVRKASMAKTAGQKTKVYSKYSKEIYVVAKNGSPDPDANL
FT                   ALRGLIERAKKDQVPGHVIDKAIDKAKGGAGEDYVPARYEGFGPGNCMVIVDCLTDNNN
FT                   RTFTDVRQCFVKTNAKIGSPGVVSHMFDHQAIFSFAGDDEDGVLEALMMADVDVTDVEV
FT                   EDGMTTVFAPNTEYFKAKTALQEAFPGIEFEMEEITFVPQTYTKIEGDDVAMFEKFLGM
FT                   LEDCDDVQNVYHNAEL"
     MGRSFEVRKA SMAKTAGQKT KVYSKYSKEI YVVAKNGSPD PDANLALRGL IERAKKDQVP        60
     GHVIDKAIDK AKGGAGEDYV PARYEGFGPG NCMVIVDCLT DNNNRTFTDV RQCFVKTNAK       120
     IGSPGVVSHM FDHQAIFSFA GDDEDGVLEA LMMADVDVTD VEVEDGMTTV FAPNTEYFKA       180
     KTALQEAFPG IEFEMEEITF VPQTYTKIEG DDVAMFEKFL GMLEDCDDVQ NVYHNAEL         238
//

If you have problems or comments...

PBIL Back to PBIL home page