(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE437

CP002209.PE437       Location/Qualifiers
FT   CDS             complement(477153..479192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0437"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="COGs: COG3563 Capsule polysaccharide export protein;
FT                   InterPro IPR007833: IPR000463; KEGG: ecp:ECP_3028 capsule
FT                   export protein KpsC; PFAM: Capsule polysaccharide
FT                   biosynthesis protein; SPTR: P42217 Capsule polysaccharide
FT                   export protein kpsC; PFAM: Capsule polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74651"
FT                   /db_xref="GOA:E1SP02"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP02"
FT                   /protein_id="ADN74651.1"
FT                   /translation="MTYYTNSAGILARQAVLHAALAQPLERLNAHAVTGKGDVYIGWGL
FT                   KPNSLAMKQQAAENGVPFWHLEDGFIGYTGHPAKGGHSLSVVVDKQGIYYDASQPSELE
FT                   QHIVDAGRDSALCERAHNLIARIRQYGITKYNVYPDFNSQTQLPSDLKQQLDGRPYVLL
FT                   VDQVAGDLSIAAAQASEADFLDMVAAARQRYPDAALVVRTHPDTRLGKKSGVLARLARH
FT                   PALQSVIWVKQACHPHALIHHCLALFTVSSQMGFEGLILDKPVHCFGQPFYAGWGLTDD
FT                   AKPHDRRAALHRAGITLPQLVAAALILYPRYVNPITGQRCEVEEIIELLALQQRPEPQY
FT                   QTLYLAGFSLWKRAFIGKFCGHLAHNIRFVSKPPKQLGHNDKLLVWGQRFTEQQDAIRV
FT                   EDGFVRSSGLGSNLCRPASLVVDQRGIYFNAQQNNDLRHLLNHLMVSEADQARGAALIH
FT                   KLVSADINKYNLISQNRYQPSAEHPLRLLVVGQVDGDASITTGSPVVTSNEALLWAVRK
FT                   AYPEAHILYKAHPDVVAGNREGQISQACYDACVDEQVAEYGLNQLYPHIHQLHTMTSLA
FT                   GFEALLRGIHVVTWGQPFYAGWGLTEDRNPAHDRNRQRTLEELVYIAIAAYPSYVDWAT
FT                   GLFTTPEWLIDLLANNKTDSSHRPNRFQRWQLKLGYLVDTLKPQ"
     MTYYTNSAGI LARQAVLHAA LAQPLERLNA HAVTGKGDVY IGWGLKPNSL AMKQQAAENG        60
     VPFWHLEDGF IGYTGHPAKG GHSLSVVVDK QGIYYDASQP SELEQHIVDA GRDSALCERA       120
     HNLIARIRQY GITKYNVYPD FNSQTQLPSD LKQQLDGRPY VLLVDQVAGD LSIAAAQASE       180
     ADFLDMVAAA RQRYPDAALV VRTHPDTRLG KKSGVLARLA RHPALQSVIW VKQACHPHAL       240
     IHHCLALFTV SSQMGFEGLI LDKPVHCFGQ PFYAGWGLTD DAKPHDRRAA LHRAGITLPQ       300
     LVAAALILYP RYVNPITGQR CEVEEIIELL ALQQRPEPQY QTLYLAGFSL WKRAFIGKFC       360
     GHLAHNIRFV SKPPKQLGHN DKLLVWGQRF TEQQDAIRVE DGFVRSSGLG SNLCRPASLV       420
     VDQRGIYFNA QQNNDLRHLL NHLMVSEADQ ARGAALIHKL VSADINKYNL ISQNRYQPSA       480
     EHPLRLLVVG QVDGDASITT GSPVVTSNEA LLWAVRKAYP EAHILYKAHP DVVAGNREGQ       540
     ISQACYDACV DEQVAEYGLN QLYPHIHQLH TMTSLAGFEA LLRGIHVVTW GQPFYAGWGL       600
     TEDRNPAHDR NRQRTLEELV YIAIAAYPSY VDWATGLFTT PEWLIDLLAN NKTDSSHRPN       660
     RFQRWQLKLG YLVDTLKPQ                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page