(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE44

CP002209.PE44        Location/Qualifiers
FT   CDS             complement(55109..56818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0044"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /EC_number="4.2.99.20"
FT                   /note="COGs: COG1165 2-succinyl-6-hydroxy-2
FT                   4-cyclohexadiene-1-carboxylate synthase; InterPro
FT                   IPR012001: IPR004433; KEGG: spl:Spea_3971
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; PFAM: thiamine pyrophosphate protein
FT                   TPP binding domain protein;
FT                   PRIAM:2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex
FT                   ene-1-carboxylic-acidsynthase; SPTR: A8H9P4
FT                   2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
FT                   carboxylate synthase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain;
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74258"
FT                   /db_xref="GOA:E1SVA4"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA4"
FT                   /protein_id="ADN74258.1"
FT                   /translation="MNTSHCAELNLLWARLMLEELHRLGVRHLCLAPGSRSTPLTLAAA
FT                   GHDGFQRHTHFDERGLGFAALGLAKASQSPVAIITTSGTAVANLYPAVIEAYQTGVPLV
FT                   VLSGDRPPELIACGANQAIIQPAIFANYARRLDLPTPSLEIPPQTLLAQLDQVMVDLDR
FT                   PLHINCMYREPLYPEGLDAPFETYLTPLSEWRKTAEPWAATPAMSRSALPSADDCCSFA
FT                   QGKGIIVVGTLGPHQQPEQILALARRLGWPILADAQSQLRQAEGVVHHIDQLMHHPKAL
FT                   KLLGKAEHLLLIGGRLLSKRLMSFIAQHPWQAFWHYMGHAENLDPAHLRKRRFVGSLPM
FT                   LAALPWPLLPGSGWADALESYSDEVERLAAEQHDQGALTELSAVRLLSRQLGADQQLFI
FT                   GNSLPIRLFDMLAAPGDAPAIFTNRGASGIDGLLATSCGVAMAEGKPTVLVVGDLSLLH
FT                   DLNSLALARSLTSPLVVMVLNNDGGSIFNMLPVPSDALRQQYYRLGHGFGFEGAASQFH
FT                   LPYQRPDSLDALQQALSEGLQRDGASVIEVVVPPNESAELIVEMARQIRGDD"
     MNTSHCAELN LLWARLMLEE LHRLGVRHLC LAPGSRSTPL TLAAAGHDGF QRHTHFDERG        60
     LGFAALGLAK ASQSPVAIIT TSGTAVANLY PAVIEAYQTG VPLVVLSGDR PPELIACGAN       120
     QAIIQPAIFA NYARRLDLPT PSLEIPPQTL LAQLDQVMVD LDRPLHINCM YREPLYPEGL       180
     DAPFETYLTP LSEWRKTAEP WAATPAMSRS ALPSADDCCS FAQGKGIIVV GTLGPHQQPE       240
     QILALARRLG WPILADAQSQ LRQAEGVVHH IDQLMHHPKA LKLLGKAEHL LLIGGRLLSK       300
     RLMSFIAQHP WQAFWHYMGH AENLDPAHLR KRRFVGSLPM LAALPWPLLP GSGWADALES       360
     YSDEVERLAA EQHDQGALTE LSAVRLLSRQ LGADQQLFIG NSLPIRLFDM LAAPGDAPAI       420
     FTNRGASGID GLLATSCGVA MAEGKPTVLV VGDLSLLHDL NSLALARSLT SPLVVMVLNN       480
     DGGSIFNMLP VPSDALRQQY YRLGHGFGFE GAASQFHLPY QRPDSLDALQ QALSEGLQRD       540
     GASVIEVVVP PNESAELIVE MARQIRGDD                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page