(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE445

CP002209.PE445       Location/Qualifiers
FT   CDS             complement(487996..488877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0445"
FT                   /product="hypothetical protein"
FT                   /note="PFAM: Protein of unknown function (DUF3118)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74659"
FT                   /db_xref="InterPro:IPR021466"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP10"
FT                   /protein_id="ADN74659.1"
FT                   /translation="MKPIIGLINFSTLCKKNSGSFISSRESDWETHKQSVLSRSRLEER
FT                   LFYFEQVSLKQFDSQVDVNYFEEFRLVILISTLLHDDLKKKVYELQVGRPWMIIEERGE
FT                   EDWLDATGAISRALISLIRGRATKYINEDKVCFASFRLDDDDFLSTNFLKSLSSYINDD
FT                   NAGKFVTFSHGFKCCWISKRIVNLVRIHKPLIAIGLSHIGQFCTKTMDFSTDPKTVFSG
FT                   VNHYKIGESSSVIEDITPGMFIWSQHSNQDTHNRFKSVEIEDYWREIPNENLYKDLGGY
FT                   DGIESHFKLNDA"
     MKPIIGLINF STLCKKNSGS FISSRESDWE THKQSVLSRS RLEERLFYFE QVSLKQFDSQ        60
     VDVNYFEEFR LVILISTLLH DDLKKKVYEL QVGRPWMIIE ERGEEDWLDA TGAISRALIS       120
     LIRGRATKYI NEDKVCFASF RLDDDDFLST NFLKSLSSYI NDDNAGKFVT FSHGFKCCWI       180
     SKRIVNLVRI HKPLIAIGLS HIGQFCTKTM DFSTDPKTVF SGVNHYKIGE SSSVIEDITP       240
     GMFIWSQHSN QDTHNRFKSV EIEDYWREIP NENLYKDLGG YDGIESHFKL NDA              293
//

If you have problems or comments...

PBIL Back to PBIL home page