(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE446

CP002209.PE446       Location/Qualifiers
FT   CDS             complement(488882..491050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0446"
FT                   /product="N-acetylgalactosaminyl-proteoglycan3-beta-glucur
FT                   onosyltransferase"
FT                   /EC_number="2.4.1.226"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: pmu:PM0775
FT                   hypothetical protein; PFAM: glycosyl transferase family 2;
FT                   PRIAM: N-acetylgalactosaminyl-proteoglycan
FT                   3-beta-glucuronosyltransferase; SPTR: Q8L0V4 Chondroitin
FT                   synthase; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74660"
FT                   /db_xref="GOA:E1SP11"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP11"
FT                   /protein_id="ADN74660.1"
FT                   /translation="MQTLISEIKNSGLFDIDWYLKQYPDVNLSGLPPVEHYLKFGWKIG
FT                   RDPSPHFSTQGYLSHYEDVRQSGLNPLAHFIRYGINEGRIKAGVKVQKPKIEALPIKPR
FT                   DTGCRFDAVTQLMLLNESGETNAPEYHELLKKVKEQQAKKSEDAETKEVDPIPGDWPKD
FT                   LQLRPLPESTNDYQWIKRYKKNALPDEIGLSVVIPTFNRSHILRVTLAAMLHQRTDYPF
FT                   EIIVADDGSQEDIPKVVREFENKLEVKYVRQKDTGYRLSAVRNLGLRTAKYEYVSILDC
FT                   DMAPNPDWIQSIINILMESDDVAVIGPRKYVDTSMLAIDYCESTPDFLAKLPEVRTNNS
FT                   VAGADAGAISVDWRLATFESTDNLRLCDSPFRFFSGGNVGFSKKWLEKAGWFDEEFEAW
FT                   GGEDGEYGYRLYRSGAFFQSHMGAMAYHQEPPGKENETDRAGGKAITEKIRLGKVPYFY
FT                   RKIASIEQAEVNPVPLVSIYIPAYNCEQYIVRCVESALNQTVSDLEVCICDDGSTDNTL
FT                   KVLQENYDNHPRVRFVSQQNGGIGAASNTAVKLCRGFYIGQLDSDDFLEPDAVELCLKE
FT                   FLKDHSLACVYTTNRNLDGEGKLLANGYNWPVYSREKLTTAMICHHFRMFTSRAWNLTD
FT                   GFDEKITNAVDYDMYLKLSEVGPFKHVNKICYNRVLHGENTSIMKLAAQKENHFKVVNE
FT                   SLYRQNLDAHVYSPYSTLDSCRKYKFTS"
     MQTLISEIKN SGLFDIDWYL KQYPDVNLSG LPPVEHYLKF GWKIGRDPSP HFSTQGYLSH        60
     YEDVRQSGLN PLAHFIRYGI NEGRIKAGVK VQKPKIEALP IKPRDTGCRF DAVTQLMLLN       120
     ESGETNAPEY HELLKKVKEQ QAKKSEDAET KEVDPIPGDW PKDLQLRPLP ESTNDYQWIK       180
     RYKKNALPDE IGLSVVIPTF NRSHILRVTL AAMLHQRTDY PFEIIVADDG SQEDIPKVVR       240
     EFENKLEVKY VRQKDTGYRL SAVRNLGLRT AKYEYVSILD CDMAPNPDWI QSIINILMES       300
     DDVAVIGPRK YVDTSMLAID YCESTPDFLA KLPEVRTNNS VAGADAGAIS VDWRLATFES       360
     TDNLRLCDSP FRFFSGGNVG FSKKWLEKAG WFDEEFEAWG GEDGEYGYRL YRSGAFFQSH       420
     MGAMAYHQEP PGKENETDRA GGKAITEKIR LGKVPYFYRK IASIEQAEVN PVPLVSIYIP       480
     AYNCEQYIVR CVESALNQTV SDLEVCICDD GSTDNTLKVL QENYDNHPRV RFVSQQNGGI       540
     GAASNTAVKL CRGFYIGQLD SDDFLEPDAV ELCLKEFLKD HSLACVYTTN RNLDGEGKLL       600
     ANGYNWPVYS REKLTTAMIC HHFRMFTSRA WNLTDGFDEK ITNAVDYDMY LKLSEVGPFK       660
     HVNKICYNRV LHGENTSIMK LAAQKENHFK VVNESLYRQN LDAHVYSPYS TLDSCRKYKF       720
     TS                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page