(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE447

CP002209.PE447       Location/Qualifiers
FT   CDS             complement(491068..493035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0447"
FT                   /product="Chromosome segregation ATPase"
FT                   /note="COGs: COG1196 Chromosome segregation ATPase; KEGG:
FT                   bcm:Bcenmc03_0851 glycosyl transferase family protein;
FT                   SPTR: A2DGN0 Viral A-type inclusion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74661"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP12"
FT                   /protein_id="ADN74661.1"
FT                   /translation="MKTQKRPRKKMTRITQTVEPSGSERIQYQKDFDMTQQNQAVTVQE
FT                   QHLPTISSKVMFWRPRYLADSQWLQHIPFYFWLTEALKPQVVVQPSLNSAVGYFALCQA
FT                   IDKLNLDSFAYGAFSPKCDVEKVKAYNHENYREFSQLSDLDENTMLREFDRGSIDLLIL
FT                   KHDCELLTSDKGRQELKERLTDSAVVLIHGTKLKHVRKLCQTLSKTYPSFELTQCQGLL
FT                   LLCMGSQIPERLEALINQSKDVSAQRLIQNIYARLGSANEDAWHRQVYERRVHDLTEKL
FT                   QQQTHTIQQIQGAKQTLSETLEQANNDIQAAKSQQAKLSERLEQFGEETELNQQQKQQL
FT                   EREKAQLDKELAQLKISRQDATSEIAKLQQDIDTRFDEVAKLTQMLVEAEARLESLQKE
FT                   NQELREALRNNKTLQEQTRSDVAQKQSHIDQLQTKVSAHQQENEQLRKALQRHQQQEEG
FT                   QQSELNKLKQQNALLERDQKVAADKISSLAQSELSLQKSLSERFDELATLTNLLQQKER
FT                   ELSGLIEQMKDSEKALTDSKPINNGNIKKTITALKQRRKKARQFAKDVEVIRQSDLFDE
FT                   AWYLQQYPDAAKHKHGAAGHYLERAVELEVNPSTAFDGNWYLKTHEDVKSAGMNPLFHY
FT                   LKFGHKESRLFKHLQVKHPN"
     MKTQKRPRKK MTRITQTVEP SGSERIQYQK DFDMTQQNQA VTVQEQHLPT ISSKVMFWRP        60
     RYLADSQWLQ HIPFYFWLTE ALKPQVVVQP SLNSAVGYFA LCQAIDKLNL DSFAYGAFSP       120
     KCDVEKVKAY NHENYREFSQ LSDLDENTML REFDRGSIDL LILKHDCELL TSDKGRQELK       180
     ERLTDSAVVL IHGTKLKHVR KLCQTLSKTY PSFELTQCQG LLLLCMGSQI PERLEALINQ       240
     SKDVSAQRLI QNIYARLGSA NEDAWHRQVY ERRVHDLTEK LQQQTHTIQQ IQGAKQTLSE       300
     TLEQANNDIQ AAKSQQAKLS ERLEQFGEET ELNQQQKQQL EREKAQLDKE LAQLKISRQD       360
     ATSEIAKLQQ DIDTRFDEVA KLTQMLVEAE ARLESLQKEN QELREALRNN KTLQEQTRSD       420
     VAQKQSHIDQ LQTKVSAHQQ ENEQLRKALQ RHQQQEEGQQ SELNKLKQQN ALLERDQKVA       480
     ADKISSLAQS ELSLQKSLSE RFDELATLTN LLQQKERELS GLIEQMKDSE KALTDSKPIN       540
     NGNIKKTITA LKQRRKKARQ FAKDVEVIRQ SDLFDEAWYL QQYPDAAKHK HGAAGHYLER       600
     AVELEVNPST AFDGNWYLKT HEDVKSAGMN PLFHYLKFGH KESRLFKHLQ VKHPN            655
//

If you have problems or comments...

PBIL Back to PBIL home page