(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE448

CP002209.PE448       Location/Qualifiers
FT   CDS             complement(493115..494779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0448"
FT                   /product="polysaccharide export protein"
FT                   /note="COGs: COG1596 Periplasmic protein involved in
FT                   polysaccharide export; InterPro IPR019554: IPR003715; KEGG:
FT                   pol:Bpro_4938 polysaccharide export protein; PFAM:
FT                   polysaccharide export protein; Soluble ligand binding
FT                   domain; SPTR: Q03961 Polysialic acid transport protein
FT                   kpsD; PFAM: Polysaccharide biosynthesis/export protein;
FT                   SLBB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74662"
FT                   /db_xref="GOA:E1SP13"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP13"
FT                   /protein_id="ADN74662.1"
FT                   /translation="MHNSILAKLALAGALSVLPLSTTFAAITFQQDVEAEQVETMSTAK
FT                   VPSQRYGSWLFNGAFSQHSFSATNPEYRLTQGDTLIVQVWGAINHQAEVVVDPQGNIFI
FT                   PKVGPIKVLGVSNAKLNEVIFKSVQRVYQANVEVYASLMSSQKVKVFLSGMVNQPGLYE
FT                   GQSADSVLRFIDQASGIRDDIGSYRNIQVKRNGRLVQQLDLYQFLQSGTLPPMQLQDGD
FT                   VIFVGPKQGEITLEGEVGFQGYYELLANGNKANPLKPILDAVVAGEQATHVTIVAPEAG
FT                   ASSAGNRRVNATQYQIEDAGTIQVSPGALVKVTAQLRPNSISIDLIGEHDSAQEMVLPW
FT                   GASLQDLLDQTQFTRLSNQSAVQLYRESVAERQYEMLQASLSALEQSVLNTRSNTREAA
FT                   ELRAAEAEVILRWIEKARQVQPKGQVLLSESSDFSQIILQQGDKVVIPAKRNLVIVHGE
FT                   VMFPTAIAYRDDLSVLDLINKAGGANQELDEMNILVMKPNGSFVTANKMLKKRDVIAPG
FT                   DEIFVLSKPDEKSMQFAKDITQIIFQVAMSAAVVLSI"
     MHNSILAKLA LAGALSVLPL STTFAAITFQ QDVEAEQVET MSTAKVPSQR YGSWLFNGAF        60
     SQHSFSATNP EYRLTQGDTL IVQVWGAINH QAEVVVDPQG NIFIPKVGPI KVLGVSNAKL       120
     NEVIFKSVQR VYQANVEVYA SLMSSQKVKV FLSGMVNQPG LYEGQSADSV LRFIDQASGI       180
     RDDIGSYRNI QVKRNGRLVQ QLDLYQFLQS GTLPPMQLQD GDVIFVGPKQ GEITLEGEVG       240
     FQGYYELLAN GNKANPLKPI LDAVVAGEQA THVTIVAPEA GASSAGNRRV NATQYQIEDA       300
     GTIQVSPGAL VKVTAQLRPN SISIDLIGEH DSAQEMVLPW GASLQDLLDQ TQFTRLSNQS       360
     AVQLYRESVA ERQYEMLQAS LSALEQSVLN TRSNTREAAE LRAAEAEVIL RWIEKARQVQ       420
     PKGQVLLSES SDFSQIILQQ GDKVVIPAKR NLVIVHGEVM FPTAIAYRDD LSVLDLINKA       480
     GGANQELDEM NILVMKPNGS FVTANKMLKK RDVIAPGDEI FVLSKPDEKS MQFAKDITQI       540
     IFQVAMSAAV VLSI                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page