(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE450

CP002209.PE450       Location/Qualifiers
FT   CDS             complement(495991..496671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0450"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1134 ABC-type polysaccharide/polyol
FT                   phosphate transport system ATPase component; InterPro
FT                   IPR003439: IPR003593: IPR017871; KEGG: fph:Fphi_1159
FT                   putative capsule polysaccharide export transport system
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: P24586 Polysialic acid transport
FT                   ATP-binding protein kpsT"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74664"
FT                   /db_xref="GOA:E1SP15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP15"
FT                   /protein_id="ADN74664.1"
FT                   /translation="MIRFDNVSKFYPTKSGRHYVLRDVNLELPTDRNIAILGPNGVGKS
FT                   TLIRLMGGADIPNRGQISSDQNISWPLGLQGGLQGSMTARENVRFVARIHGYKDTKPIE
FT                   RRVEEFAEIGKYFDEPVKSYSSGMRSRITFGLTMAFDFDFDVLLIDELGAVGDANFRNK
FT                   SEALLQSKFERTKLIMVSHSLKELKTYCQSGLVLINQQLHYFEHLNDAITLYQDTYVKP
FT                   ISKA"
     MIRFDNVSKF YPTKSGRHYV LRDVNLELPT DRNIAILGPN GVGKSTLIRL MGGADIPNRG        60
     QISSDQNISW PLGLQGGLQG SMTARENVRF VARIHGYKDT KPIERRVEEF AEIGKYFDEP       120
     VKSYSSGMRS RITFGLTMAF DFDFDVLLID ELGAVGDANF RNKSEALLQS KFERTKLIMV       180
     SHSLKELKTY CQSGLVLINQ QLHYFEHLND AITLYQDTYV KPISKA                      226
//

If you have problems or comments...

PBIL Back to PBIL home page