(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE451

CP002209.PE451       Location/Qualifiers
FT   CDS             complement(496668..497474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0451"
FT                   /product="ABC-2 type transporter"
FT                   /note="COGs: COG1682 ABC-type polysaccharide/polyol
FT                   phosphate export systems permease component; InterPro
FT                   IPR013526: IPR013525: IPR000412; KEGG: ebr:ECB_02828
FT                   polysialic acid transport protein KpsM; PFAM: ABC-2 type
FT                   transporter; SPTR: P24584 Polysialic acid transport protein
FT                   kpsM; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74665"
FT                   /db_xref="GOA:E1SP16"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP16"
FT                   /protein_id="ADN74665.1"
FT                   /translation="MNTTNTLIRPPKRSHWQITCDVVFALIIRELKTRFGANRLGYFWA
FT                   LAEPIAQAGIMVLIFTLLGRNSISGVPVALFMLVAILPFKFFSKLVPQLTAAVEANKGL
FT                   LSYRQVTAADPILSRVIIETVTFLVVYLLLMATLAWLNFSVVPENLLALLGVSALVLML
FT                   ALGLGLMLCSAVTYWKDTGKVVAMVMQPMFFISGIFFCATMIPQQYWYLFSWNPLFHVT
FT                   ELSRDAYFSAYTTPVGSWEYLGLWAFSCFTLGLMTFRVCQQRFITS"
     MNTTNTLIRP PKRSHWQITC DVVFALIIRE LKTRFGANRL GYFWALAEPI AQAGIMVLIF        60
     TLLGRNSISG VPVALFMLVA ILPFKFFSKL VPQLTAAVEA NKGLLSYRQV TAADPILSRV       120
     IIETVTFLVV YLLLMATLAW LNFSVVPENL LALLGVSALV LMLALGLGLM LCSAVTYWKD       180
     TGKVVAMVMQ PMFFISGIFF CATMIPQQYW YLFSWNPLFH VTELSRDAYF SAYTTPVGSW       240
     EYLGLWAFSC FTLGLMTFRV CQQRFITS                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page