(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE453

CP002209.PE453       Location/Qualifiers
FT   CDS             complement(498726..499691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0453"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /note="COGs: COG0042 tRNA-dihydrouridine synthase; InterPro
FT                   IPR001269: IPR018517: IPR004652; KEGG: pha:PSHAa0347
FT                   tRNA-dihydrouridine synthase B; PFAM: dihydrouridine
FT                   synthase DuS; SPTR: Q8EJR8 tRNA-dihydrouridine synthase B;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   Dihydrouridine synthase (Dus); TIGRFAM: putative TIM-barrel
FT                   protein, nifR3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74667"
FT                   /db_xref="GOA:E1SP18"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP18"
FT                   /protein_id="ADN74667.1"
FT                   /translation="MTLKIGPYHLDNQLIVAPMAGVTDLPFRQLCRRLGAGLAVSEMLS
FT                   SNPLVWATEKSMARMDHSSESGIRSVQIAGCEPELMAQAAQFNVERGAQIIDINMGCPA
FT                   KKVNKKLAGSALLRHPDLVRQILHAVVNAVEVPVTLKIRTGWDPDNRNGVEIAQIAEQS
FT                   GIAALAVHGRTRQCMYKGEAEYDTIAAIKRSVSIPVIANGDIDSPEKAKFVLDHTGVDG
FT                   LMIGRPAQGRPWIFREIQHYLATGEHLAPPSLEERKELMTGHLEHLHAFYGDERGMRIA
FT                   RKHVGWYLDNQQQPELRRQFNALDSACAQRDALAGFFEQH"
     MTLKIGPYHL DNQLIVAPMA GVTDLPFRQL CRRLGAGLAV SEMLSSNPLV WATEKSMARM        60
     DHSSESGIRS VQIAGCEPEL MAQAAQFNVE RGAQIIDINM GCPAKKVNKK LAGSALLRHP       120
     DLVRQILHAV VNAVEVPVTL KIRTGWDPDN RNGVEIAQIA EQSGIAALAV HGRTRQCMYK       180
     GEAEYDTIAA IKRSVSIPVI ANGDIDSPEK AKFVLDHTGV DGLMIGRPAQ GRPWIFREIQ       240
     HYLATGEHLA PPSLEERKEL MTGHLEHLHA FYGDERGMRI ARKHVGWYLD NQQQPELRRQ       300
     FNALDSACAQ RDALAGFFEQ H                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page