(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE455

CP002209.PE455       Location/Qualifiers
FT   CDS             500994..501659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shl:Shal_3899 fumarate reductase cytochrome
FT                   b-556 subunit; PFAM: Succinate dehydrogenase/Fumarate
FT                   reductase transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74669"
FT                   /db_xref="GOA:E1SP20"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP20"
FT                   /protein_id="ADN74669.1"
FT                   /translation="MDTPFASPRRFALYRRWLQATLGGILALECLLSFQWGFGQILGPR
FT                   PLSPIRDWIHGCPQEHTLSEWAATIILLSLFFLHGYLAMTQPYEKPPLKERHGFGRKPA
FT                   VCWEAVYHHVQVATGILLVPLTFIFCYTLMLSPPDPTVDDWYHRMTSLGSRLAYVMLIP
FT                   LLLLHATLGLARLVVRWRTSNPEAPYHGSRKWVLGSYAVLISSALTIAVIRGVPGFSF"
     MDTPFASPRR FALYRRWLQA TLGGILALEC LLSFQWGFGQ ILGPRPLSPI RDWIHGCPQE        60
     HTLSEWAATI ILLSLFFLHG YLAMTQPYEK PPLKERHGFG RKPAVCWEAV YHHVQVATGI       120
     LLVPLTFIFC YTLMLSPPDP TVDDWYHRMT SLGSRLAYVM LIPLLLLHAT LGLARLVVRW       180
     RTSNPEAPYH GSRKWVLGSY AVLISSALTI AVIRGVPGFS F                           221
//

If you have problems or comments...

PBIL Back to PBIL home page