(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE464

CP002209.PE464       Location/Qualifiers
FT   CDS             complement(514806..516113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0464"
FT                   /product="AAA ATPase"
FT                   /note="InterPro IPR003593; KEGG: ppd:Ppro_3564 hypothetical
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74678"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP29"
FT                   /protein_id="ADN74678.1"
FT                   /translation="MIGGIETHSECYYIKEHFRNAALDYTTDDPFQFTAGVKLYKDAQE
FT                   AEGASDSEITGHIINFVHRHNPEMMHVITPFLKTTKAAVEKQLQKLRQEAQAKASTFEN
FT                   FVLTDSQIEERLQQMSDDVMLAGGMVVKGQMTVFFAPPNTGKTLIVLTMLARDADSGLL
FT                   DGGGVIYINCDDGGKGAITKAKILHASGINAIVLGENGFKSQHLATLMAASCASGAAAN
FT                   QVIVLDTLKKFVDVMNKKDAPAFYEELRRFTMAGGTVISLAHCNKNRDESGKLVFGGVA
FT                   DSVDDTDAAYIIDPANESNSELKTVLAENIKRRGENVKEVAFQYDESDGLSYQERMNSV
FT                   DMIEGTKAKEFKTKADCERAIQAKRARLQDDANKILEVLMDEGGEVMVTSLVNAVYKQE
FT                   FVSRRTARNVIDLFNNELWLVQKEGKSKIVRHLYRS"
     MIGGIETHSE CYYIKEHFRN AALDYTTDDP FQFTAGVKLY KDAQEAEGAS DSEITGHIIN        60
     FVHRHNPEMM HVITPFLKTT KAAVEKQLQK LRQEAQAKAS TFENFVLTDS QIEERLQQMS       120
     DDVMLAGGMV VKGQMTVFFA PPNTGKTLIV LTMLARDADS GLLDGGGVIY INCDDGGKGA       180
     ITKAKILHAS GINAIVLGEN GFKSQHLATL MAASCASGAA ANQVIVLDTL KKFVDVMNKK       240
     DAPAFYEELR RFTMAGGTVI SLAHCNKNRD ESGKLVFGGV ADSVDDTDAA YIIDPANESN       300
     SELKTVLAEN IKRRGENVKE VAFQYDESDG LSYQERMNSV DMIEGTKAKE FKTKADCERA       360
     IQAKRARLQD DANKILEVLM DEGGEVMVTS LVNAVYKQEF VSRRTARNVI DLFNNELWLV       420
     QKEGKSKIVR HLYRS                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page