(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE469

CP002209.PE469       Location/Qualifiers
FT   CDS             complement(520297..520749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0469"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="COGs: COG0511 Biotin carboxyl carrier protein;
FT                   InterPro IPR001249: IPR000089: IPR001882; KEGG: vpa:VP2880
FT                   acetyl-CoA carboxylase biotin carboxyl carrier protein
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; SPTR: A3UWB2 Acetyl-CoA carboxylase; TIGRFAM:
FT                   acetyl-CoA carboxylase, biotin carboxyl carrier protein;
FT                   PFAM: Biotin-requiring enzyme; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74683"
FT                   /db_xref="GOA:E1SP34"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP34"
FT                   /protein_id="ADN74683.1"
FT                   /translation="MDIRKIKKLIELVQESGIAELEITEGEESVRIASTSTAPAPVTYA
FT                   APAPVAAAPAAAPAAAPAAPAAEAAEPAGHKVLSPMVGSFYRAPTPGAKPFVEVGDTVN
FT                   VGDTLCIIEAMKMMNQIEADKAGVIKAILAENGDPIEFDEPLFIIE"
     MDIRKIKKLI ELVQESGIAE LEITEGEESV RIASTSTAPA PVTYAAPAPV AAAPAAAPAA        60
     APAAPAAEAA EPAGHKVLSP MVGSFYRAPT PGAKPFVEVG DTVNVGDTLC IIEAMKMMNQ       120
     IEADKAGVIK AILAENGDPI EFDEPLFIIE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page