(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE47

CP002209.PE47        Location/Qualifiers
FT   CDS             complement(58884..60428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0047"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="COGs: COG0554 Glycerol kinase; InterPro IPR018484:
FT                   IPR018485: IPR018483: IPR005999; KEGG: saz:Sama_0341
FT                   glycerol kinase; PFAM: Carbohydrate kinase, FGGY-like;
FT                   SPTR: A1S2E6 Glycerol kinase; TIGRFAM: glycerol kinase;
FT                   PFAM: FGGY family of carbohydrate kinases, N-terminal
FT                   domain; FGGY family of carbohydrate kinases, C-terminal
FT                   domain; TIGRFAM: glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74261"
FT                   /db_xref="GOA:E1SVA7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA7"
FT                   /protein_id="ADN74261.1"
FT                   /translation="MMKTNPQAKPAMSSEQFILALDQGTTSSRALLFNRQGTILGSAQR
FT                   EFTQHYPQSGWVEHDAMEIWASQRAVLTEVLARCGVRHEQVAAIGITNQRETTVIWDAE
FT                   TGQPIHNAIVWQCRRTADLCEALKAKGLEQHVRDTTGLVLDPYFSGTKIAWLLDQVPGA
FT                   RERAERGELRFGTIDCWLLWQLTDGAVHATDRTNAARTLLWDIHQQRWDPTLLDALNIP
FT                   ASLLPEVKSSQELFGHAQIGRARIPVAGIAGDQQAALFGQLCTQPGMAKNTYGTGCFML
FT                   MHTGDQAVQSRHGLLTTIACSGPEQVEYALEGAVFMGGASVQWLRDELGLIRHASETQA
FT                   LAQSVPDTAGAYLVPAFTGLGAPYWDPYARGALVGLTRGCNRQHIVRATLESIAYQSRD
FT                   LLDAMQLDAALPLTELRVDGGAVANDFLMQFQADILATPVLRPHNRESTAAGAAYLAGL
FT                   TVGYWPDRASLAGLNQTERRFESTMDDTQRQQLYSGWQDAVGRTLVTKAPHPGSGQ"
     MMKTNPQAKP AMSSEQFILA LDQGTTSSRA LLFNRQGTIL GSAQREFTQH YPQSGWVEHD        60
     AMEIWASQRA VLTEVLARCG VRHEQVAAIG ITNQRETTVI WDAETGQPIH NAIVWQCRRT       120
     ADLCEALKAK GLEQHVRDTT GLVLDPYFSG TKIAWLLDQV PGARERAERG ELRFGTIDCW       180
     LLWQLTDGAV HATDRTNAAR TLLWDIHQQR WDPTLLDALN IPASLLPEVK SSQELFGHAQ       240
     IGRARIPVAG IAGDQQAALF GQLCTQPGMA KNTYGTGCFM LMHTGDQAVQ SRHGLLTTIA       300
     CSGPEQVEYA LEGAVFMGGA SVQWLRDELG LIRHASETQA LAQSVPDTAG AYLVPAFTGL       360
     GAPYWDPYAR GALVGLTRGC NRQHIVRATL ESIAYQSRDL LDAMQLDAAL PLTELRVDGG       420
     AVANDFLMQF QADILATPVL RPHNRESTAA GAAYLAGLTV GYWPDRASLA GLNQTERRFE       480
     STMDDTQRQQ LYSGWQDAVG RTLVTKAPHP GSGQ                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page