(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE472

CP002209.PE472       Location/Qualifiers
FT   CDS             complement(521855..522262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein; PFAM:
FT                   Uncharacterized protein conserved in bacteria (DUF2057)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74686"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP37"
FT                   /protein_id="ADN74686.1"
FT                   /translation="MKARYWPLMALFCPLAMAGELHLPEGFYATAVNGQAVSPHQNRLN
FT                   LGSGRQVVTLRYANPYLFHKEFHEVLVSAPLYLVFDASNQHYRISATLPTELEAARRFA
FT                   RDPEFSLTSQQQPIPYQTYRYNQAVNALLSR"
     MKARYWPLMA LFCPLAMAGE LHLPEGFYAT AVNGQAVSPH QNRLNLGSGR QVVTLRYANP        60
     YLFHKEFHEV LVSAPLYLVF DASNQHYRIS ATLPTELEAA RRFARDPEFS LTSQQQPIPY       120
     QTYRYNQAVN ALLSR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page