(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE474

CP002209.PE474       Location/Qualifiers
FT   CDS             523237..524271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_4075 hypothetical protein; SPTR:
FT                   A0Y741 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74688"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP39"
FT                   /protein_id="ADN74688.1"
FT                   /translation="MLQLVVGPEARRQISQSGLQPELFDKVIAASGGPKWIPLAALDRH
FT                   LLYQFFPAEQPLSLLGTSSGAWRCTTLSNPGSDAAHRRLQHAYIHQRYDRPPMPAEVDA
FT                   MCEGILSDALGECAPAICDNLYRQLNIIVCRGRHLNDSARRGSQLAGLAFTALTNLARR
FT                   RSLSMSWQRLVASTGLDTPFVPMDDLPTEAAPLDANNLLPVMLASGSIPLVLSGVTGIP
FT                   GLPPGRYFDGGVTDYHLDLPALQRGGLTLYPHFYPHAAPGWFDKKLPWRRASTNFDKVA
FT                   ILTPDPTFIARLPRGRLPDRSDFKTLDSDRRIRDWERAAELGEALVDTFQKLVQDPMPY
FT                   LRSL"
     MLQLVVGPEA RRQISQSGLQ PELFDKVIAA SGGPKWIPLA ALDRHLLYQF FPAEQPLSLL        60
     GTSSGAWRCT TLSNPGSDAA HRRLQHAYIH QRYDRPPMPA EVDAMCEGIL SDALGECAPA       120
     ICDNLYRQLN IIVCRGRHLN DSARRGSQLA GLAFTALTNL ARRRSLSMSW QRLVASTGLD       180
     TPFVPMDDLP TEAAPLDANN LLPVMLASGS IPLVLSGVTG IPGLPPGRYF DGGVTDYHLD       240
     LPALQRGGLT LYPHFYPHAA PGWFDKKLPW RRASTNFDKV AILTPDPTFI ARLPRGRLPD       300
     RSDFKTLDSD RRIRDWERAA ELGEALVDTF QKLVQDPMPY LRSL                        344
//

If you have problems or comments...

PBIL Back to PBIL home page