(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE479

CP002209.PE479       Location/Qualifiers
FT   CDS             complement(528387..528794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0479"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG1607 Acyl-CoA hydrolase; InterPro
FT                   IPR006683; KEGG: slo:Shew_1159 thioesterase superfamily
FT                   protein; PFAM: thioesterase superfamily protein; SPTR:
FT                   A2UVA8 Thioesterase superfamily; PFAM: Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74693"
FT                   /db_xref="GOA:E1SP44"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP44"
FT                   /protein_id="ADN74693.1"
FT                   /translation="MKYYSRRVIKPEDLNPGQSLFGGRLLSWLDEEAGIFAACQMGSHQ
FT                   LVTRQIRDITFHRPGRQGEVIEFGLALTHTGRTAVTVRCEVRNKQSLAVLATVEAMVFV
FT                   NLDANGRPSPHKLAPGRRANRVSTPDRKPGL"
     MKYYSRRVIK PEDLNPGQSL FGGRLLSWLD EEAGIFAACQ MGSHQLVTRQ IRDITFHRPG        60
     RQGEVIEFGL ALTHTGRTAV TVRCEVRNKQ SLAVLATVEA MVFVNLDANG RPSPHKLAPG       120
     RRANRVSTPD RKPGL                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page