(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE484

CP002209.PE484       Location/Qualifiers
FT   CDS             533336..533626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0484"
FT                   /product="chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR001476: IPR018369; KEGG: eum:ECUMN_4677 co-chaperonin
FT                   GroES; PFAM: chaperonin Cpn10; SPTR: Q3YUJ8 10 kDa
FT                   chaperonin; PFAM: Chaperonin 10 Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74698"
FT                   /db_xref="GOA:E1SP49"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E1SP49"
FT                   /protein_id="ADN74698.1"
FT                   /translation="MNIRPLHDRVIVKRTEVETKSAGGIVLTGSAAEKSTRGEVLAVGN
FT                   GRILENGEVKALDVKVGDTVIFNEGYGVKTEKVDGQEVLIMSESDILAIVE"
     MNIRPLHDRV IVKRTEVETK SAGGIVLTGS AAEKSTRGEV LAVGNGRILE NGEVKALDVK        60
     VGDTVIFNEG YGVKTEKVDG QEVLIMSESD ILAIVE                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page