(data stored in SCRATCH9089 zone)

EMBL: CP002209.PE49

CP002209.PE49        Location/Qualifiers
FT   CDS             complement(61376..63967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fbal_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0992 hypothetical protein; SPTR: A3U4C3
FT                   Transcriptional regulator, AraC family with Parallel
FT                   beta-helix repeat (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Fbal_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADN74263"
FT                   /db_xref="UniProtKB/TrEMBL:E1SVA9"
FT                   /protein_id="ADN74263.1"
FT                   /translation="MKRTPSVPFKHPRTVLLVAMTAAGIALPSLAVVPEADNPIFNTPA
FT                   NSADSCMADAYIETGGKGLKDKVGQVINCTAEDVEIAEVTVKAVDGETSSTGDFTCTLG
FT                   DTIEVTADLRVRTNAAERYDTTFFVSRDLDSPQVVQQDEEACSILIPKNDFKGTGNAQN
FT                   LDADQCGDIAKSGLVNDEYTLVNAVFTMTCTASPGSERVEFNYCAAWDVQEDPANCSAT
FT                   GAAPGQEPSSKSKCNCDIIPLNIFIQPDPAKITKTLKSASNSGTEPMATFEYEVKIERG
FT                   STDADLVITDIDDLYRSVADSGSPKVGSSDAPILFDLDGTNSDTTIGNLTLLGADNKCY
FT                   DTVPVTLTAASPTFTCTFKVKVSDEDLPDALDPTEATPMPPAGEEEYQNFIRITSVDLN
FT                   GDNIGDNTCDVTDNLTSNDEGNCSNVIAVKITNVDPSIVITKTPVAGPGLQNIGGAWFV
FT                   EDQGLITYEITITNNSTVDALSLLALTDTSVTNLLNDSSGTPACNTYPASLSANGGKFT
FT                   CRYIVNVTLVDGASYPNTVNVDAKDNENRRTDDMAMVTITRATPSVVLVKKVAKSGDVG
FT                   IPTPAIDSASFMDSVTIDEPGGSAHPVVYRFTVTNNNTTTKEDLTLNSLEDNVLFGSVR
FT                   ATAAPVQRSDECAFPQTLVFGTPYVCTLVAYVDGNATNVSDTAYDDTQLVNTAFVKATS
FT                   TQGKQIQSQPDSATVLFKDVPPTVTGKYGLAGTIFIAVKNTSFEAIWLSELSIFNTPVK
FT                   DGNLFNGYRIVNDGGTLTGIDEDPTTPVSDAPLACEEPGYTLKLDPGEEYVCAFTVELA
FT                   DFNEGDFAEFQADILRGAPNRNVVVKFVDEEGTPVTTDAEVQVKTGDNIDQ"
     MKRTPSVPFK HPRTVLLVAM TAAGIALPSL AVVPEADNPI FNTPANSADS CMADAYIETG        60
     GKGLKDKVGQ VINCTAEDVE IAEVTVKAVD GETSSTGDFT CTLGDTIEVT ADLRVRTNAA       120
     ERYDTTFFVS RDLDSPQVVQ QDEEACSILI PKNDFKGTGN AQNLDADQCG DIAKSGLVND       180
     EYTLVNAVFT MTCTASPGSE RVEFNYCAAW DVQEDPANCS ATGAAPGQEP SSKSKCNCDI       240
     IPLNIFIQPD PAKITKTLKS ASNSGTEPMA TFEYEVKIER GSTDADLVIT DIDDLYRSVA       300
     DSGSPKVGSS DAPILFDLDG TNSDTTIGNL TLLGADNKCY DTVPVTLTAA SPTFTCTFKV       360
     KVSDEDLPDA LDPTEATPMP PAGEEEYQNF IRITSVDLNG DNIGDNTCDV TDNLTSNDEG       420
     NCSNVIAVKI TNVDPSIVIT KTPVAGPGLQ NIGGAWFVED QGLITYEITI TNNSTVDALS       480
     LLALTDTSVT NLLNDSSGTP ACNTYPASLS ANGGKFTCRY IVNVTLVDGA SYPNTVNVDA       540
     KDNENRRTDD MAMVTITRAT PSVVLVKKVA KSGDVGIPTP AIDSASFMDS VTIDEPGGSA       600
     HPVVYRFTVT NNNTTTKEDL TLNSLEDNVL FGSVRATAAP VQRSDECAFP QTLVFGTPYV       660
     CTLVAYVDGN ATNVSDTAYD DTQLVNTAFV KATSTQGKQI QSQPDSATVL FKDVPPTVTG       720
     KYGLAGTIFI AVKNTSFEAI WLSELSIFNT PVKDGNLFNG YRIVNDGGTL TGIDEDPTTP       780
     VSDAPLACEE PGYTLKLDPG EEYVCAFTVE LADFNEGDFA EFQADILRGA PNRNVVVKFV       840
     DEEGTPVTTD AEVQVKTGDN IDQ                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page